DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31343 and aopep

DIOPT Version :9

Sequence 1:NP_732652.1 Gene:CG31343 / 326133 FlyBaseID:FBgn0051343 Length:961 Species:Drosophila melanogaster
Sequence 2:XP_012827019.1 Gene:aopep / 100145347 XenbaseID:XB-GENE-986050 Length:822 Species:Xenopus tropicalis


Alignment Length:507 Identity:112/507 - (22%)
Similarity:163/507 - (32%) Gaps:143/507 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PELQREFLVLTQTTAGEAFGAN------TNWTITINYTGI-------------HRSDMGGFYISS 175
            ||.|.:..:...|....|.|..      ..|::.|:..||             :::...|..: .
 Frog   194 PESQWKEQLFNYTKCSRAPGCGDLMFIMDKWSLRISKAGIKMPTNFPSAIRIWYQTTTNGSSV-K 257

  Fly   176 YTDDDGEQHFLATTQFESTNARHAFPCYDEPARRANFTITIHHDPSYTAISNMPVNTAATSSGVT 240
            :|.|...:|.:.|.. ...|.|..|||.:.|...:.:..||.....:..:.: ..|.|...|...
 Frog   258 WTKDQSGRHCVYTIG-SPINNRALFPCQEPPVAMSTWHATIQAACEFVVLMS-GENCATPYSSCE 320

  Fly   241 AF------QTTP-KMSTYLVA--------------FIVSDFESTTGELNGIR------------- 271
            .|      .|.| ..||:.:|              ...||..:.....||.|             
 Frog   321 GFFSWFYYVTMPMPASTFTIAVGCWEEIKENSSCNIKTSDLSTPLYINNGSRLKEQKCKHMEYPC 385

  Fly   272 --------------QRVFSRKGKQDQQEWALWSGLLVESSLASYFGV----PFALPKLDQAGIP- 317
                          .|||:......|....|..  ||...|.:...|    ||  |:||...:| 
 Frog   386 RFSLPEACAQAIIPHRVFASHVLFKQCSEVLLP--LVSPCLEAAHAVLGTHPF--PRLDILVVPS 446

  Fly   318 DFSAGAMENWGLATYREQYMWWNKQNSTINLKTNIANIIGHEYAHMWFGDLVSIKWWTYLWLKEG 382
            :||     :.|:|:....|:   .|:.........|..:.||.||.|||.::..:.||..|:.||
 Frog   447 NFS-----SLGMASPHIIYL---SQSVLYGSNHLCATRLCHEIAHAWFGLVIGARDWTEEWISEG 503

  Fly   383 FAT------------LFSYESND----IAFPLW-----------DTYQIFHVNDYNSALLNDALA 420
            |||            |...|:.|    .|...|           :..||...:..|:..:|::.|
 Frog   504 FATHLEDVFLANVQKLPQEEARDQQKLKALLRWRRLTDELKDSQEELQILRPHGENTGKVNESGA 568

  Fly   421 SAVPMTHYVQTPSEISNRYNTF---SYAKPASVLYMFKNAWTDKVFRTGLNKYLT-KNQYTSCDE 481
            |.|  .|.:       |...||   .|.|...:|....|.       ||.:.|.. ..|:.:...
 Frog   569 SVV--RHGL-------NAEKTFMQVHYLKGYFLLRSLANT-------TGQDAYFAFLRQFVNTCH 617

  Fly   482 WDLFAS------FQESADELGFTLPASVDDIFSSWSHQAG--YPLLTVTRNY 525
            ..|..|      ..||..||. .....|..|:..|....|  .|||..:|.:
 Frog   618 GQLILSKDFLHMLFESVPELN-RQHLCVQAIYEIWLDTPGIPQPLLGESRTW 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31343NP_732652.1 Peptidase_M1 57..446 CDD:279741 91/417 (22%)
M1_APN_2 65..517 CDD:189008 108/497 (22%)
ERAP1_C 591..886 CDD:288671
aopepXP_012827019.1 GluZincin 233..652 CDD:387391 97/450 (22%)
Leuk-A4-hydro_C 731..821 CDD:378127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.