DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CHKov2

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:442 Identity:107/442 - (24%)
Similarity:181/442 - (40%) Gaps:55/442 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDKLDAEQFNDDELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPASA--QGDHYASVMFRT 63
            |||:           ..|.|:.::....:|.  :.:...|.: :|..|.||  :|::|.:::.|.
  Fly     1 MTDQ-----------PTPQWVTKELFSSLLE--QSNRNFKAI-IKFVPTSAISKGENYLTIVLRI 51

  Fly    64 TAECTTAKGKF---SRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDT 125
            ..|........   |..|.|..:||.:  |.|.   ..:|:.|:.||..::||.|.:..::...:
  Fly    52 QIEMQLKDNSIEDVSYILKIPLVPEDE--KNDF---HEMFDAELDMYDHLIPELEDLYAKNTSIS 111

  Fly   126 KLFVPC-IYHSLEPRK--VMIFEDLVPQGY-YVIRDRPVAQEELKTAFAKLAKWHAISMKYIKEQ 186
            ..|.|. :....||.|  .::.|||..:|| ...|.:.:.|.|::....|||:|||.|.|.:.|.
  Fly   112 PKFKPVHLKFPGEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVEL 176

  Fly   187 PDFLKEFKYGLFEMPTVK-TDPFITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKE 250
            .::.|:.:...|.....| .|.|.......|:|.:.:.    ..:|....:...|..:|..:..|
  Fly   177 GEYEKDIRESYFTTEHQKLLDEFNINFCMPFLECMQQY----NLEPGQLVLISDYTSQLTDLNIE 237

  Fly   251 YHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISN--------LCPITIDLTYS 307
            :.:|...: ..||.||||...|.||| .|.....||...||||:..        ||.:.....:|
  Fly   238 FGKNDPLE-LSVLNHGDFWCNNFMFK-YKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFS 300

  Fly   308 IYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPL 372
            |        :.:.....|.:|...||..|..:.|....||.:|....:|:...:.|......||:
  Fly   301 I--------KLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPI 357

  Fly   373 ILAIKSKSFKVNDLIQDPET----RQKTYFLDTYVKDVSKLLPKFEQLGYFK 420
            :|........:.:::.:.|.    ::|.:.|..||..:..:||.....||.:
  Fly   358 VLLPPDVDSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGYIR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 78/304 (26%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 78/304 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.