DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG10562

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster


Alignment Length:408 Identity:94/408 - (23%)
Similarity:182/408 - (44%) Gaps:33/408 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKFSRPLIIKA 82
            |.|:..:..|::|.|..|... |:.:.|....||.|::||::|.|...|.....||......:..
  Fly     7 PDWVTAEIFEDLLKANVDGYS-KIKNFKADIGSAAGENYATIMLRVKIEVELQDGKSKSVSYMVK 70

  Fly    83 MPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLEPRKV--MIFE 145
            :|.|....::|:..:::||.|..||.:|:||.|.:.:..|.|  :......:.|:..|.  :..|
  Fly    71 LPHQVEAIQEMMKRTNIFEIERTMYNEVVPELEALYKAVGVD--ITFGAKNYDLKNAKTDYVALE 133

  Fly   146 DLVPQGY-YVIRDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFI 209
            ||..:|: ...|...:.||..:....||::|||.|...:..:..:.|....|.|:..:......:
  Fly   134 DLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAVRVATKGPYPKILLQGFFKEESRPVMSEM 198

  Fly   210 TTGM-QSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAV----MKEYHENRKSD--AFYVLCHGD 267
            ..|| .:|::      ....|:.|     :.|:.:::|:    :.:..|..|.:  .|.||.|||
  Fly   199 IKGMGANFVK------SCATYEGH-----EAYLDKVKALQPVAIDKIFEFAKVEPTEFNVLNHGD 252

  Fly   268 FHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTV- 331
            ....|:||:.: ..|..::..|||:|:.....:..||.|  ::|...:...::.|  .::|:.: 
  Fly   253 SWSNNIMFQYD-AFGKIKEVYLVDYQLPKYGTVAQDLLY--FLLSSTKLEDKLAK--FDYYIKIY 312

  Fly   332 ---LVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDLIQDPETR 393
               ||..||.:.|...:|:...:...:.|..|:.:.:.:..:..:|...:.|..:.:.|...:.:
  Fly   313 HDNLVEHLKILKYSKPIPSLRDIHLALFKYGYFGYTVATGVMSAVLLDPTDSASLENFIGGSDFQ 377

  Fly   394 QKTYFLDTYVKDVSKLLP 411
            .:.|....|.|.:..::|
  Fly   378 MQLYNSPRYRKHIQAVMP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 73/302 (24%)
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 73/301 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.