DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG10553

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:426 Identity:103/426 - (24%)
Similarity:178/426 - (41%) Gaps:38/426 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EQFNDDELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPAS------AQGDHYASVMFRTTAE 66
            |..:..::..|.|:.....||:|...       |.|.|.|.:.      |.|::||:||.|...:
  Fly     8 EDVSQKQVTIPDWVKPTVFEELLKRI-------VKDYKATKSMRANAGVAAGENYATVMLRIELD 65

  Fly    67 CTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPC 131
            ........:....:...|.|....:.::.::.:|:.|.|||.:|:||.|::.|:.|.:.| |...
  Fly    66 VEKEDNTQTTKAFMLKTPHQSEQYRKVIEKTDIFDVERGMYVEVVPELEQLYRDVGLEVK-FGAE 129

  Fly   132 IYHSLEPRKVMIFEDLVPQGYYVIRDRPVAQEELKT--AFAKLAKWHAISMKYIKEQPDFLKEFK 194
            :|........::.|||.|:|:..| ||....::..|  ...|.|:|||.|...::.:..:.:::.
  Fly   130 LYDIEASDYYVLLEDLRPRGFGNI-DRLEGMDQAHTECVLKKFAQWHAASAVRVETKGPYQEKYT 193

  Fly   195 YGLFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKEYHE------ 253
            .|......: .|.||...::.|::.:           |..|..:.|:..|:.|..:..|      
  Fly   194 KGFLRNEEI-VDAFINRSIKVFLDNV-----------HLCKGYETYLNDLRIVSGKTFEIVESLN 246

  Fly   254 NRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRR 318
            |...|.|..|.|||....|:|.:.|. .|..:||..||.|:.....:|.||.|.:......:.:.
  Fly   247 NPSPDEFIALNHGDGWANNIMSQYNT-KGEIQDTYFVDLQVPKWGSVTQDLYYFLLSSTSLDIKT 310

  Fly   319 EMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKV 383
            ......|..|.:.||..||.:||...|||..::.|.::|...:.|...:|.|..:|.........
  Fly   311 SKFDYFIWFYHSELVKHLKLLGYSKTLPTLRRINDALNKYSGWSFICTATILAYVLLDPVDGADF 375

  Fly   384 NDLIQDPET--RQKTYFLDTYVKDVSKLLPKFEQLG 417
            :.::.|.:.  :...|....:.|.:..|||..:..|
  Fly   376 DKVLGDDDCSFKNSLYINPRFRKHMEVLLPWLQHRG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 74/296 (25%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 74/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.