DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG10550

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:435 Identity:115/435 - (26%)
Similarity:190/435 - (43%) Gaps:51/435 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKFSR 76
            ::.|..|.|:|.::.:.|:....::.: |:::|....|:|.|::|.|:|.|...:.....|...|
  Fly    14 NEHLHIPKWINEEYFQPIIEKDVENFD-KIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQR 77

  Fly    77 -PLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIY-HSLEPR 139
             ..|:|.|.|.|. ..|::....||..|..||...:|:|.::.:|:|.:.:|...|:: .:.:..
  Fly    78 VSYILKTMLEADS-GADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDEL 141

  Fly   140 KVMIFEDLVPQGYYVIR-----DRPVAQEELKTAFAKLAKWHAISM--KYIKEQPDFLKEFKYGL 197
            ..|:||||..|.:....     |.|..:|.|:    |||:.||.|:  |.|....|.:    |.:
  Fly   142 ITMVFEDLSRQNFKNFDRLKGFDLPHMREVLR----KLAELHAASVVAKEINGPYDAM----YNM 198

  Fly   198 FEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFE-KIKDKYMQRLQAVMKEYHE----NR-K 256
            ........|.|.:.|.|       |..:..|...::: :..:.|:.|:...::.:.|    |: .
  Fly   199 SIYNEQSRDLFESLGKQ-------REEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQVNQVD 256

  Fly   257 SDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMG 321
            .|.|.||.|||....|:|| |.|..|..:.|:|||.|:........||.|.|......:.:.:..
  Fly   257 EDEFNVLNHGDCWSNNIMF-NYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEF 320

  Fly   322 KDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFF--------LLSTFLPLILAIKS 378
            ...|..|...|...||.:.|...:||...|...:.|   |.|:        :::|.:|   ..|.
  Fly   321 DHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLK---YGFWGPLTAMGVMVATLMP---TDKD 379

  Fly   379 KSFKVNDLIQDPET---RQKTYFLDTYVKDVSKLLPKFEQLGYFK 420
            .:.|: .|.|.||.   |.:|:....|.|.:..|||.|:..|..|
  Fly   380 ANMKM-ILAQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLLK 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 81/303 (27%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 81/303 (27%)
APH 108..338 CDD:279908 64/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459747
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.