DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG31097

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:419 Identity:110/419 - (26%)
Similarity:182/419 - (43%) Gaps:37/419 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPASA-QGDHYASVMFRTTAECTTAKGKFS 75
            ::.|..|.|||:...|.:::  :|.|:...:|...|.|:. .|.::||||.|...:.....|...
  Fly     7 NESLVVPKWLNKSKFESLIA--KDEPDFTKIDQFTTVAAVPPGGNFASVMLRVYLDIVMKDGSQK 69

  Fly    76 R-PLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCI-YHSLEP 138
            | ..::|.|.|.|...| .::|...|..|..||...||:||:|.|.:|...:|...|: ...::.
  Fly    70 RKSYVVKTMLESDKGGK-AVNEMRYFHKEQQMYSTYLPQFEKIYRVAGHPVQLMPKCLEIGEIDG 133

  Fly   139 RKVMIFEDLVPQGYYVI-RDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPT 202
            ....|||||..:.:... |.:.|..|.::.:..|||:.||.|:.|.:....:..:|..|......
  Fly   134 NIYFIFEDLSTRNFVAADRTKGVNMEHMRLSLRKLAELHAASVIYKERYGPYHADFDNGFARKDK 198

  Fly   203 VKTDPFITTGMQSFIEMLDRLPELRKYKPHFEK--IKDKYMQRLQAVMKEYHE------NRKSDA 259
            ::         .|......:.||   ||...:.  |.:.|::..... ::|.:      |.....
  Fly   199 IE---------HSVRRFEVKAPE---YKAAMKTWGIDECYLKNFPTT-EQYGKLCLESLNVDPQD 250

  Fly   260 FYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDL 324
            |.||.||||...|::||.|: .||..:.:::||||......|.||...|.:....:...:...::
  Fly   251 FNVLTHGDFSPSNILFKYNE-NGAPSEALILDFQICKWASPTQDLLMLIILSARKDSSYKEFDNI 314

  Fly   325 INHYLTVLVATLKSIGYPGELPTQAKLWDEIHK--NKYYDFFLLSTFLP--LILAIKSK---SFK 382
            :..|...|:..|:.:.|...||...:|...|:|  |.:..||.:...||  |:...|..   :|.
  Fly   315 VRIYWEYLIDFLRVLKYKKPLPQLRELQSAIYKKNNTFSAFFAVMNHLPGDLLPVCKENNLHTFN 379

  Fly   383 VNDLIQDPETRQKTYFLDTYVKDVSKLLP 411
            :.|.: ....|.|.|....:|:.|.:|.|
  Fly   380 LEDEV-GKSFRTKVYTNPIFVEVVKELYP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 77/299 (26%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 77/299 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459733
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.