DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG10513

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster


Alignment Length:425 Identity:117/425 - (27%)
Similarity:206/425 - (48%) Gaps:25/425 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLDAEQFNDDELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAEC- 67
            |.||.:|:    .||.||:..::|.:|...::.|.|::.||.|.||:|:||:|||||.|..... 
  Fly     6 KEDATEFH----PAPEWLDETYLERLLRDLKNDPGLRITDLVIKPATAKGDNYASVMTRVRILFL 66

  Fly    68 -TTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPC 131
             :.||...:...|:|...|.|.....:.|:..:..||:.||.::||:...::.::....|:|...
  Fly    67 KSGAKSPETEYYIVKTTYENDAFASGIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFAKT 131

  Fly   132 IYHSLEPRKVMIFEDLVPQGYYVIRDRPVA--QEELKTAFAKLAKWHAISMKYIKEQPDFLKEFK 194
            ::...| .:.:|||||... .||:.||.|.  .|..:....||||.||.:....:.||..|.:|.
  Fly   132 LHVDYE-HEAIIFEDLAVT-KYVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGLLTKFD 194

  Fly   195 YGLFEMPTVKTDPFITTGMQSFIEMLDRLPEL-RKYKPHFEKIKDKYMQRLQAVMKEYHENRKSD 258
            :|:|...|....||....:....:.....||| .:|....:|::::.|:....|    ::.:..|
  Fly   195 HGIFNRHTQAFAPFFVNTVGVAADFARECPELGERYATKLKKLQERVMEYSTRV----YDPQPGD 255

  Fly   259 AFYVLCHGDFHLRNMMFK--NNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMG 321
             |..|.|||:.:.|:|.:  .||   ...|..|:|||..:.....:||.|.....::.:.|.|..
  Fly   256 -FNTLVHGDYWVNNVMLRYGENK---EPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQ 316

  Fly   322 KDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDL 386
            ..|..:|.||||.|||.:.:.|.:||..:...::.:.:::...:......::...::.....|.|
  Fly   317 DALFQYYHTVLVETLKDLNFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTNDQNADADFNAL 381

  Fly   387 IQDPE---TRQKTYFLDTYVKD-VSKLLPKFEQLG 417
            ::|.|   ..:|..:.:..::| :.:.||:|::.|
  Fly   382 MKDDERGRNFRKVLYTNKRLQDNLKRELPRFDRSG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 86/295 (29%)
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 86/295 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.