DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG14314

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:419 Identity:89/419 - (21%)
Similarity:172/419 - (41%) Gaps:83/419 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKFSRPLI 79
            :|:...|:.:..::|....|  |::::...::...|.:||:|.:.::|..........|:.:.:|
  Fly    20 VESKQILSLEVFQDIFKHVE--PDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQNVI 82

  Fly    80 IKAMPE----QDGHKKDMLSESHLFETEIGMYCQVLPEFERI-LRESGDDTKLF--VPCIY---H 134
            .|.|||    ::.:|.|     .||..|:..|..::||..:. ..::..||.:|  :|..|   |
  Fly    83 CKVMPESVVAREAYKSD-----KLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSARH 142

  Fly   135 SLEPRKVMIFEDLVPQGYYVI-RDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLF 198
            .|     :|.|||..:|:.:. |.:.::.||.::...::|:.|.:|:.|..|:|   .||.    
  Fly   143 DL-----LIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKP---LEFS---- 195

  Fly   199 EMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVM---KEY----HENRK 256
            .:.::.::....|...|:            |:.::|::....:|.:..|:   .:|    ::..:
  Fly   196 NLCSMISEGIFCTANTSW------------YRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFAE 248

  Fly   257 SDAFY--------------VLCHGDFHLRNMMFKNNKGTGAHED---------TMLVDFQISNLC 298
            |.:|:              .:||||..:.|.::        |.|         ..|:|||:....
  Fly   249 SSSFFGRMVKLASTESPLSAICHGDCWVNNFLY--------HYDPEDPHRVLEVALLDFQLIRYS 305

  Fly   299 PITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSI--GYPGELPTQAKLWDEIHKN-KY 360
            .|.:|:...:|.....|.|....:.|:..|...|...|:.:  ..|....|..||.|...:. |.
  Fly   306 SIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEELKT 370

  Fly   361 YDFFLLSTFLPLILAIKSKSFKVNDLIQD 389
            |..|.|...|.::......|....|:..|
  Fly   371 YGRFALGLALDILPISTCSSEDAPDMYLD 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 70/331 (21%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 70/326 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.