DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG6830

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:422 Identity:105/422 - (24%)
Similarity:187/422 - (44%) Gaps:32/422 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKFSRPLIIKA 82
            |.|||:...||:|:|..|... |:|..::.||.|.|::||::|.|.:.:.............:..
  Fly    47 PKWLNQTQFEELLAADVDQFS-KIVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFMMK 110

  Fly    83 MPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYH---SLEPR--KVM 142
            :|......:.|:|.::.|.:|...|.::||:.|.:.:..|.|.| |.|..:.   :.||:  ..:
  Fly   111 VPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIK-FAPRAFKLDATKEPKVANTV 174

  Fly   143 IFEDLVPQGYYVI-RDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLF----EMPT 202
            :..||...|:..| |...:..|:.|.|..:||::||.....::....:...|..|:.    |...
  Fly   175 LMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVMGNNKEAII 239

  Fly   203 VKTDPFITTGMQSFIEMLDRLPELRKYKPHFEK-IKDKYMQRLQAVMKEYHENRKSDAFYVLCHG 266
            ...:..:.:...||:..||:.....:|:...|| :....|:.::..:.:.:|      |..|.||
  Fly   240 AFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMKLGIVDPNE------FNALNHG 298

  Fly   267 DFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTV 331
            |..:.|::||.| .:|..||.:.||||........:||.|.|...::.:.:.......|.||...
  Fly   299 DCWMNNLLFKMN-SSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEA 362

  Fly   332 LVATLKSIGYPGELPTQAKLWDEIHKN--KYYDFFLLSTF--LPLILAIKSKSFKVNDLIQDP-- 390
            ||..|..:|:.|..|:..    |:|:.  ||..:.|..|.  |||:|...::|...::.:.|.  
  Fly   363 LVKHLGILGFTGRKPSLR----ELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFMSDSAD 423

  Fly   391 --ETRQKTYFLDTYVKDVSKLLPKFEQLGYFK 420
              ..|...|......:.:.::||..:..|:.:
  Fly   424 GVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 71/299 (24%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 71/299 (24%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459817
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.