DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG5644

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster


Alignment Length:486 Identity:96/486 - (19%)
Similarity:167/486 - (34%) Gaps:154/486 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NRQFIEEILSAYEDSPELKVVDLKI-----TPASAQGDHYASVMFRTTAECTTAKGKFSRPLIIK 81
            |.:.:.::.|      :.|:|...|     :..|:.||:|.||:.|.|              |.:
  Fly    35 NAEHLRQLFS------QSKLVSFSIAHIACSAGSSSGDNYMSVVKRVT--------------ISQ 79

  Fly    82 AMPEQDGH-----------KKDMLSES--------HLFETEIGMYCQVLPEFERILRESGDDTKL 127
            |..:||..           |:.:.|.|        ..|..||..|..:.|     |..:....:|
  Fly    80 AGKDQDPELAGSEIVTVIVKRQIASLSRRQLYRCEEAFSNEINAYRHLAP-----LLAAHSRHQL 139

  Fly   128 FVPCIYHSLEPRK-------VMIFEDLVPQGYYVIRDRPVAQE--ELKTAFAKLAKWHAISMK-- 181
            |..|.....:.|:       :::.:||...|:. ::||....|  :......|||:.||.|:.  
  Fly   140 FPVCHIAESQDRRDAEGGEPIIVLQDLKAMGFR-MKDRLAGLELSDCLLVMKKLAQLHAASLAAQ 203

  Fly   182 ------------------YIKEQPDFL-----KEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRL 223
                              |..|..||.     ...:..|..:.....|..:||.::...|:...|
  Fly   204 ELESSSFAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRTNL 268

  Fly   224 PELRKYKPHFEKIKDKYMQRLQAVMKEYHENRKSDAF--YVLCHGDFHLRNMMFKNNKGTGAHED 286
                     ||.:|              ||...:.|.  .|:||||..:.|:||::..     |:
  Fly   269 ---------FENLK--------------HEINATAAAPNSVICHGDLWVNNIMFRSEP-----EE 305

  Fly   287 TMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIG----YPGELPT 347
            .:..|.|.........|:.:.||    ...||.: :|:  |..|:|.|..:::.    :..|..|
  Fly   306 VIFFDLQAMRKSSPIFDILHFIY----TSTRRPL-RDV--HTDTLLAAYSQALSEELRHQLEDTT 363

  Fly   348 QAKLWDEI-------------HKNKYYDFFLLSTFLPLILAIKSKSFKVNDL----------IQD 389
            .|:..:|:             .:..:|...:....||.:      :|..|:|          :..
  Fly   364 AAERLEELCEAFSLQRLSSDYVRQVHYGLAIGMWILPAV------TFDPNNLPNLDVMSEQNLTG 422

  Fly   390 PETRQKTYFLDTYVKDVSKLLPKFEQLGYFK 420
            .|.:........|...:.:|:.:|.:|||.:
  Fly   423 KEIKCTQMLTSEYHMRIRELVMEFYELGYLQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 73/347 (21%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 73/346 (21%)
P-loop_NTPase <357..435 CDD:304359 11/83 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.