DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and JhI-26

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:434 Identity:97/434 - (22%)
Similarity:169/434 - (38%) Gaps:106/434 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKLDAEQFNDDELEAPAWLNRQFIEEIL---SAYEDSPELKVVDLKITPASAQGD-------HYA 57
            :|::||:         .||....:..||   ...::..|.||....:      ||       |..
  Fly     2 EKIEAER---------QWLRYTVLPSILRNGRLVDNYSESKVTTFHV------GDIDIDVIGHSE 51

  Fly    58 SVM----FRTTAECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERIL 118
            :.|    :|||........||.|.:::|..|.......:.:....||..||..|.::||||::. 
  Fly    52 AFMLTFCYRTTINFEYDGQKFQRKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQKF- 115

  Fly   119 RESGDDTKLFVPCIY------HSLEPRKVMIFEDLVPQGYYVIRDR-PVAQEELKTAFAKLAKWH 176
                .|.|...|..|      ||    .|.|.|:...||:.|.:|| .::.:....|.:.|.::|
  Fly   116 ----TDGKFAAPKYYYGELNQHS----AVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFH 172

  Fly   177 --AISMKY-----IKEQPDFLKEFKYGLFEMP-----TVKTDPFITTGMQSFIEMLDRLPE-LRK 228
              |.:||:     ..:..|.|||.:|....:.     |:||.             :||..: :..
  Fly   173 GFAYAMKHKNPEKFAQLTDNLKESRYANDNIHPEWKLTMKTS-------------IDRAAKAVAT 224

  Fly   229 YKPHFEKIKDKYMQRLQAVMKEYHENRKS-----DAFYVLCHGDFHLRNMMFKNNKGTGAHEDTM 288
            |:|   :|.::::::...::.:|.:..:.     :....|||||:...|:.::.:......| .|
  Fly   225 YQP---QIDEEFVKKFCFMISDYSQYGRQRVAPREPLATLCHGDYVRNNVAYRYDDKEEPQE-IM 285

  Fly   289 LVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWD 353
            :.|:|...:....:||...:.:.:..|.|....:.:...|...|..:.:                
  Fly   286 MFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCEYTLALHNSYR---------------- 334

  Fly   354 EIHKNKYYDFF----LLS---TFLPLILAIKSKSFKVNDLIQDP 390
            |..|.:..||.    ||.   .|||..|:| |.||.::  :.||
  Fly   335 EHAKEEVPDFLSRGELLKEYVRFLPYSLSI-SASFLMS--LVDP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 71/324 (22%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 67/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.