DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and F59B1.10

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:411 Identity:91/411 - (22%)
Similarity:153/411 - (37%) Gaps:112/411 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKF-SRPLIIKAMPEQDGH 89
            :||.:.||.:|             |.:..|...:.|...|      ||| |:.|:|   |:...:
 Worm   105 VEEQMYAYFES-------------SCKKMHNQEMNFYEVA------GKFNSKTLLI---PKVYFY 147

  Fly    90 KKDMLSESHLFETEIGM-YCQVLPEFERILRESGDDTKLFVPCIYHSLEP--RKVMIFEDL---- 147
            .|  |.|.:..:..||| |.:     ..|:|.|.|      .|....::|  |.:...:.|    
 Worm   148 TK--LDEKNSNKGFIGMEYVE-----GSIVRHSYD------TCTIEEIQPILRAIAKLQALSLQN 199

  Fly   148 ---VPQGYYVIRDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFI 209
               :.:....|.:..:.||.||...::      ..:|.|.||...|:..::|             
 Worm   200 PAEISKDLQKIDNGAIFQETLKMMLSE------SGIKGIFEQCRNLERSRFG------------- 245

  Fly   210 TTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKEYHENRKSDAFYVLCHGDFHLRNMM 274
                    |.:||:.|.|.....|||..:  :.::..:.:.           ||||||....|.:
 Worm   246 --------EKVDRIEEKRNEILDFEKAFN--LNKVVGIKQN-----------VLCHGDLWAANFL 289

  Fly   275 FKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSI 339
            :..|.|...  .|.:||:|:|:|.....||...:...:....|:...:.::..:.:..:..|.| 
 Worm   290 WTENNGVFC--ATRIVDYQMSHLGNPAEDLVRLLVSTITGADRQAHWQQILEQFYSYFLNELGS- 351

  Fly   340 GYPGELP---TQAKLWDEIHKNKYYD---FFLLSTFLPLILAIKSKSFKVNDLIQDPETRQKTYF 398
               ||.|   .|.||..::    |:.   ..||..|.|.:.|      |:..:  |.|..:|...
 Worm   352 ---GEAPYTLEQLKLSFKL----YFPVGALALLPLFGPAVDA------KLEGM--DSEKAEKCRH 401

  Fly   399 LDTYVKDVSKLLPKFEQLGYF 419
            :  .::.|:.||...|:...|
 Worm   402 V--VIEKVACLLDDLEKYHKF 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 64/299 (21%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 91/411 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.