DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG33509

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:415 Identity:100/415 - (24%)
Similarity:171/415 - (41%) Gaps:80/415 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EEIL-SAYEDSPELKVVDL----KITPASAQGDHYASVMFRTTAECTTAKGKFSR-PLIIKAMPE 85
            ::|| :|.|.:..:|::|.    .::.....||:||    .|...|...:..... .|.:||||:
  Fly     8 QKILENAQESAVRVKLLDYHLVRDLSAIGYLGDYYA----LTLRYCHEEEEIIREIELFVKAMPQ 68

  Fly    86 QDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLEPRKVMIFEDLVPQ 150
            |...    ||:..:|:.|..:|..::.:.:.:     .:.|....|:|   ..:.:|:.|::..:
  Fly    69 QSAE----LSKESIFQKESWLYDTLIKKLQAL-----SNVKWSPNCVY---SRKDLMVLENIKLK 121

  Fly   151 GYYVIRDRPVAQEELKTAFAK-----LAKWHAISMKYIKEQPDFLKEFKYG--LFEMPTVKTDPF 208
            |:     ......||...|.|     :|.:|:.|:.| :.|........||  |.|:.......:
  Fly   122 GF-----TSAGSAELNEVFVKPLIKSIAAFHSASLVY-EHQTKTNIGHTYGDNLLEITVDSEIAW 180

  Fly   209 ITTGMQSFIEMLDRLPELRKYKPHFEK--IKDKYMQRLQAVMKEYHENRKSDAFY--VLCHGDFH 269
            .|||:.:.:.:   :..|.||:.:.|:  |.||    |..:|:..:|.......|  ||||.|..
  Fly   181 FTTGLSAVLAV---VRSLAKYQGNREQSFIGDK----LMGIMETIYEQAAPSKKYRNVLCHRDIW 238

  Fly   270 LRNMMF-KNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLV 333
            ..|:.| ..|.|     ..:|:|||.....|...||.:.:||.:...:|::|.|..|:.|.|.|:
  Fly   239 AGNIFFPPENSG-----PALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLL 298

  Fly   334 ATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSK---SFKVNDLIQDPETRQK 395
            ..|..:|....:.::::|.:     .|.:|.|.......:.|...|   .|..||.         
  Fly   299 QNLSDLGLEELVISKSELLE-----SYEEFRLFGVVYRAVAATVVKVPTDFITNDF--------- 349

  Fly   396 TYFLDTYVKDVSKLLPKFEQLGYFK 420
                 .|| |.||::     |.|.|
  Fly   350 -----KYV-DRSKVI-----LSYMK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 76/301 (25%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 69/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459870
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.