DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG33510

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:398 Identity:89/398 - (22%)
Similarity:159/398 - (39%) Gaps:82/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VVDLKITPASAQGDH------YASVMFRTTAECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHL 99
            :::..|.||:   :|      |..:.|:...|  ..|...:..|.:|::..|:.:.:..:.:..|
  Fly    41 LLNFNIVPAT---EHTGFLGEYFHLYFQYQLE--DQKDVQTSRLFVKSVIFQNANMEFYMEKMGL 100

  Fly   100 FETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLEPRK-VMIFEDLVPQGYYVI--RDRPVA 161
            .|.||.:| .:|.|.::..:....     ..|.:    .|| :.:.:::...||..:  ..|.:.
  Fly   101 IEKEIKLY-DLLNELKKFSKHVWS-----AKCYF----TRKDLFVMQNVEDMGYVALPPGTRFLN 155

  Fly   162 QEELKTAFAKLAKWHAISMKYIKEQPDFL-KEFKYGLFEMPTVKTDP---FITTGMQSFI----- 217
            :.::......||..||.|:.|.|:|...: .||:..|.|   |..||   :.|||:::.:     
  Fly   156 ENQMGPILKSLATLHASSIAYEKQQGKTIGVEFRKWLKE---VSVDPEVEWYTTGLRAVLAVAAI 217

  Fly   218 --EMLDRLPELRKYKPHFEKIKDKYMQRLQAVM-----KEYHENRKSDAFYVLCHGDFHLRNMMF 275
              ::||. ||.::|      |..:..:.|..|.     ...|.|       |..|.|....|:.:
  Fly   218 HPDVLDN-PEAQEY------IAQELPRCLDKVYCMVNPSPVHRN-------VFVHRDAWNANVFY 268

  Fly   276 KNNKGTGAHED-TMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSI 339
            ...|   .||: ::|||||:....|..:|.....|:.:||..|::|...||..|...|....:.:
  Fly   269 HKEK---PHEERSILVDFQLCRYSPPAMDFHLVTYLNLEPFSRKKMIGSLIETYYDALAEEFREM 330

  Fly   340 GYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDLIQDPETRQKTYFLDTYVK 404
            |..   |.|.:|..:..:....||.|.......|.|         .:::.|         |.|:|
  Fly   331 GVN---PYQEQLSKQEFEQSLNDFSLFGATYNCIAA---------TVLRLP---------DNYLK 374

  Fly   405 DVSKLLPK 412
            ::....|:
  Fly   375 NLKDERPE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 72/314 (23%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 54/214 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459877
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.