DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG33511

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:382 Identity:82/382 - (21%)
Similarity:166/382 - (43%) Gaps:50/382 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GDHYASVMFRTTAECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERI 117
            |::|   .....||....|.|:.....||::|.::..:::......:|:.|..:|.|:||:.::.
  Fly    44 GEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKY 105

  Fly   118 LRESGDDTKLFVPCIYHSLEPRKVMIFEDLVPQGYYVIRDRPVAQEELKTAFAKLAKWHAISMKY 182
            ..:     ||:..|.|   ....:::.|||.....::..:.....:..|.....|::.||.|:.:
  Fly   106 ATK-----KLYPKCYY---SRNDILVLEDLTQDYRHLRANEYYTLDHYKIVLEHLSELHAASIAW 162

  Fly   183 -IKEQPDFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIK-DKYMQRLQ 245
             .||.....:.:|..|.|:.....:.:..||:::.:.:..|       .|||:.:| ..::|.  
  Fly   163 EEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAAR-------NPHFQTMKAQNFIQD-- 218

  Fly   246 AVMKEYHENRKSDAFY--------VLCHGDFHLRNMMFKNNKGTGAHEDT-MLVDFQISNLCPIT 301
               |.|:...|::...        ||||.|....|:::..||.:....:. .:||||::..|..|
  Fly   219 ---KLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPT 280

  Fly   302 IDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLL 366
            :|:.:.:|::...|.||.:..:.:.||...|...|..:|....|.|:.....|..:.:     |.
  Fly   281 LDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTR-----LA 340

  Fly   367 STFLPLILAIKSK-SFKVNDLIQDPETRQKTYFLDTYVKDVSKLL-------PKFEQ 415
            :..:..:...::| |..:::.::..|..:..|:|:.   |.|:||       |.:|:
  Fly   341 ALVIWALTEPQTKMSPSISNRLRSEEPEKFDYYLNC---DRSELLLRVIEIQPGYEE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 66/298 (22%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 66/297 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.