DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG31974

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:405 Identity:91/405 - (22%)
Similarity:159/405 - (39%) Gaps:76/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GDHYASVMFRTTAECTTAKGKF-SRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFER 116
            ||:|.|:|....|:..:|.|.. ..|||.|..|..:.....:........||..:|..:.||.::
  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDK 100

  Fly   117 ILRESGD-DTKLF--VPCIYH---SLEPR-------KVMIFEDLVPQGYYV-IRDRPVAQEELKT 167
            :..|||. ..::|  .|..|.   ||:.|       .|::.|::..:||.. .|.||....|...
  Fly   101 LQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVL 165

  Fly   168 AFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPH 232
            ....||::||:.:....::|...:|:....|:    |.|      |.|.|:..:  .|:.. |..
  Fly   166 ILHYLAQYHALPIALRLKKPQVYEEYVRPYFK----KFD------MNSNIDQAE--TEIMN-KEI 217

  Fly   233 FEKIK-----DKYMQRLQAVMKEYHENRKSD-----AFYVLCHGDFHLRNMMFKNNKGTGAHEDT 287
            .:.||     ::.:.|::.::..:...:.|:     .|..|.|||..:.|||.|  .|....|.|
  Fly   218 LKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLK--YGMRGEEGT 280

  Fly   288 ML----VDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQ 348
            .|    |||||:....:..|:.:.::..::.....:...:.:..|....:.||:|:         
  Fly   281 PLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSV--------- 336

  Fly   349 AKLWDEIHKNKY-YDFFLLSTFLPLILAIKSKSFKVNDLIQDPETRQKTYFLDTYVKDV------ 406
                 .:..:.| |:.||........:.:....|.:..::.|..|..|.|      |||      
  Fly   337 -----NVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDY------KDVDFSVLT 390

  Fly   407 -----SKLLPKFEQL 416
                 ..::.|||.:
  Fly   391 KNTGAKTIVTKFEAI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 76/316 (24%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 76/329 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.