DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG7135

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:433 Identity:105/433 - (24%)
Similarity:193/433 - (44%) Gaps:75/433 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDKLDAEQFNDDELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTA 65
            |:|.|:         |.|.:|..||....|.......:|:|:.:::|..:..|::|.|.::|...
  Fly     1 MSDALE---------EPPLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQI 56

  Fly    66 ECTTAKG-KFSRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLF- 128
            :...|:. .....||:|:||::   |:.:|:..|::..|...|..:.|:.|.::..:.|....: 
  Fly    57 KYRNAESCAMETSLIVKSMPDE---KQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWT 118

  Fly   129 -VPCIYHS-LEPRKVMIFEDLVPQGYYV-IRDRPVAQEELKTAFAKLAKWHAISMKYIKEQPD-F 189
             .|..|:| .:|.:.:|.|||...||.: .|...:..:......||||::||::|...:.:|: .
  Fly   119 LAPKHYYSTTQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETI 183

  Fly   190 LKEFKYGLFEMPTVKTDPF-----------------------ITTGMQSFIEMLDRLPELRKYKP 231
            :..:.:||..|..:.::||                       |||             :|.:|..
  Fly   184 VDRYPFGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITT-------------KLYRYHE 235

  Fly   232 HF-EKIKDKYMQRLQAV--MKEYHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQ 293
            || |::       |:||  ::..|.        ||.|||..:.|:.||.: .....:...::|||
  Fly   236 HFTERV-------LKAVYPLRGNHN--------VLNHGDLWVNNIFFKYD-AEYTVQQVKIIDFQ 284

  Fly   294 ISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKN 358
            :.....:..|:.|.:...:|.|..|:..::|::.|...||..||.:.:..|||:...:.|||.|.
  Fly   285 LCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKR 349

  Fly   359 KYYDFFLLSTFLPL--ILAIKSKSFKVNDLIQDPETRQKTYFL 399
            :.|.||:...|.||  ::.:.|:...:.:...:...|||...:
  Fly   350 EAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHDETFARQKVQLM 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 76/320 (24%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 76/318 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.