DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG31099

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:430 Identity:103/430 - (23%)
Similarity:192/430 - (44%) Gaps:73/430 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAWLNRQFIEE-ILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECT------------- 68
            |.|::...:.: :.|..||..::..|...:        |.  :.||   .||             
  Fly     7 PDWVSSLSLNQAVHSVLEDGVQITSVIPSV--------HL--IQFR---NCTVLLPIQVKVQLRD 58

  Fly    69 -TAKGKFSRPLIIKAMPEQDGHKKD----MLSESHLFETEIGMYCQVLPEFERILRESGDDTKLF 128
             |.|..|   .::||.     |..|    ::::..:|:.|..:|..|||:.|.|.||.|.... |
  Fly    59 FTMKKLF---FLLKAQ-----HGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVS-F 114

  Fly   129 VPCIY---HSLEPRKVMIFEDLVPQGY-YVIRDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDF 189
            .|..:   :|:..:.|:: |||..:.| .|.|.....:..||....|||::||.|...::     
  Fly   115 GPRAFRLDYSIGVQYVLL-EDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVE----- 173

  Fly   190 LKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDR----LPELRKYK--PHFEK-IKDKYMQRLQAV 247
                |:|.|.  .:..:...|...:|.::.|:.    |.:||:::  .||.| :.:|....:..:
  Fly   174 ----KHGAFS--NLLVNGVYTKANESVLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGL 232

  Fly   248 MKEYHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLM 312
            :|.:..:  |:.|.||.|.|..:.|:|||.: .:|..|||.|:|:|:.......|||.|:|....
  Fly   233 LKLHSPD--SNEFNVLNHSDCWVNNVMFKFD-DSGHVEDTALLDYQLVKYGSPAIDLYYTILSSA 294

  Fly   313 EPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIK 377
            |.:.:.....:::.:|...|:..||::.:.|.||....:.|.::||....:.:::..||:.:..:
  Fly   295 EKDIKLAQFDNMVQYYFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQ 359

  Fly   378 SKSFKVNDLIQDPETRQKTYFLDT--YVKDVSKLLPKFEQ 415
            .:. :||:..   .::.|.....:  |::.:..:||..|:
  Fly   360 FED-EVNERY---ASKMKCAMFTSRKYIQAIKDILPWMEE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 82/317 (26%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 79/302 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.