DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG31288

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:416 Identity:119/416 - (28%)
Similarity:183/416 - (43%) Gaps:65/416 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NDD------ELEAPAWLNRQFIEEILSAYEDSPE-LKVVDLKITPASAQGDHYASVMFRTTAECT 68
            |||      .|..|.|:|.::.|.:|:  :|.|: :||:...:..|...|:::.|.|.|...:..
  Fly     4 NDDIVNPNEHLIIPDWINEKYFESVLA--KDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLE 66

  Fly    69 TAKGKF-SRPLIIKAM-PEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPC 131
            ...|.. ::..|.|.| ||:.|...  ::|..||..|..||...||.||.:.::.|.|.:|...|
  Fly    67 MKDGSVKTKTYIFKTMLPEERGGSD--INEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKC 129

  Fly   132 IYHSLEPRK---VMIFEDL-VPQGYYVIRDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKE 192
            ::  .|.|:   ..||||| |.:...:.|.:.:..|.:.....|||::||.|..|.:....:..|
  Fly   130 LH--TEEREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSE 192

  Fly   193 FKYGLFEMPTVKTD--PFITTGMQSFIEMLDRLPELRKYKPHF----EKIKDKYMQRLQAVMKEY 251
            |..|.     ||.|  .|...|.|        |.| :.||...    .|..|||::....| |:|
  Fly   193 FSEGF-----VKKDVKKFHVDGFQ--------LKE-KAYKKAMLSWGLKDADKYIKAFPTV-KQY 242

  Fly   252 HENRKS------DAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYM 310
            .....|      |.|:||.||||...|:| .:....|..|..:|:||||.......:||.:  ::
  Fly   243 WAQCLSTLELNPDEFHVLNHGDFWSSNLM-SSYLPDGTLEKLILIDFQIVMWGSPAMDLLF--FL 304

  Fly   311 LMEPEQRREMGKDL----INHYLTV----LVATLKSIGYPGELPTQAKLWDEI-HKN-KYYDFFL 365
            .:.|.      .||    .:|::.:    ||..||.:.....||....|.:.: :|| .:|.||.
  Fly   305 TLSPT------NDLRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFS 363

  Fly   366 LSTFLPLILAIKSKSFKVNDLIQDPE 391
            :...||:||....|...:::|..:.|
  Fly   364 ILNHLPIILFPTDKDSNIHNLSANTE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 90/314 (29%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 88/308 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459726
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.