DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and CG2004

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:342 Identity:73/342 - (21%)
Similarity:130/342 - (38%) Gaps:82/342 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KITPASAQGDHYASVMFRTT------AECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLFETE 103
            |..|:..:||.|.|.:||.|      ||....:.:....:|:||||: :.|::.:......|..|
  Fly    35 KFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPD-NLHRRRLFRSVIFFRNE 98

  Fly   104 IGMYCQVLP------------------EFERILRESGDDTKLFVPCIYHSLEPRKVMIFEDLVPQ 150
            |..|.:|||                  |:.|.|....|....|:             ..||:.|:
  Fly    99 INFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFI-------------ALEDVGPR 150

  Fly   151 GYYV-IRDRPVAQEELKTAFAKLAKWHAISM-------KYIKEQPDFLKEFKYG----------L 197
            ||.. :|...::.|:.......|.::|.:::       |..::....|:|..||          |
  Fly   151 GYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYTGFL 215

  Fly   198 FEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPH--FEKIKDKYMQ--RLQAVMKEYHENRKSD 258
            .....|.||                  .:::..|:  :|.:...::|  ....::.......|..
  Fly   216 LLAENVATD------------------AVKQIYPNSKYETVATNFLQPPLFDDLINLVSTRSKLS 262

  Fly   259 AFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKD 323
            .|   .|||....|.:.|.|: .|..|:.:::|||::....:.:||::.||.....|.|.:...:
  Fly   263 VF---GHGDCWTPNFLTKYNE-RGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDE 323

  Fly   324 LINHYLTVLVATLKSIG 340
            |:..||......::.:|
  Fly   324 LLRAYLESAQDLIQDLG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 71/335 (21%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 70/333 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.