DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and T16G1.6

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans


Alignment Length:451 Identity:74/451 - (16%)
Similarity:142/451 - (31%) Gaps:155/451 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDKL--DAEQFNDDELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRT 63
            :.||:  ..:..|::|            ||:.:.:|:              .||..|...|.|..
 Worm    89 IVDKMKESNQSINENE------------EELWAMFEN--------------EAQHLHNREVNFYV 127

  Fly    64 TAECTTAKGKFSRP-------LIIKAMPEQDGHKKDMLSESHLFETEI-GMYCQVLP-EFERILR 119
            .||      |:::|       :......:.:...|..|...::.:..| .:||.:.| |...:|:
 Worm   128 LAE------KWNKPEELLNAKIFFSKKFDSENKLKGFLGMEYVDDVTIRHLYCNLKPYELHPVLK 186

  Fly   120 E-------------------SGDDTKLFVPCIYHSLEPRKVMIFEDLVPQGYYVIRDRPVAQEEL 165
            .                   ||.|.|..:..:::          :|.:...|...||        
 Worm   187 AVAQLQAESLHLSDEELQSISGFDFKQMMGTMFN----------DDGLKGNYKQTRD-------- 233

  Fly   166 KTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYK 230
                        |:.:.:||:.|.::.|                  ||                 
 Worm   234 ------------INPERLKEKTDIVEAF------------------GM----------------- 251

  Fly   231 PHFEKIKDKYMQRLQAVMKEYHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQIS 295
               |.:..::...|..|:..:.:        ||.|||....|:::  |:..|....:.::|:||.
 Worm   252 ---EVVNFEFAGNLNKVVGIHKD--------VLVHGDLWAANILW--NENDGKFSASKVIDYQII 303

  Fly   296 NLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKY 360
            ::.....||.......:....|:...:.|:..:....:..|:....|..|       |:: |..|
 Worm   304 HMGNPAEDLVRVFLCTLSGADRQAHWEKLLEQFYEYFLEALEDNEIPYTL-------DQL-KESY 360

  Fly   361 YDFFLLST--FLPLILAIKSKSFKVNDLIQDPETRQKTYFLDTYVKDVSKLLPKFEQLGYF 419
            ..:|:..:  .|||...|..     ..|....:|.....:.:...:...|||...|...::
 Worm   361 RLYFVTGSLVMLPLYGPIAQ-----TKLSYSKDTEHVEEYREILTEKAEKLLEDMEHWHFY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 50/316 (16%)
T16G1.6NP_506234.2 DUF1679 8..417 CDD:369592 74/451 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.