DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and H37A05.2

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:361 Identity:79/361 - (21%)
Similarity:143/361 - (39%) Gaps:74/361 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KDMLS-ESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCI-------YHSLEPRKVMIFEDL 147
            |.|.| ...|...|:.||       ..|:||     |...|.:       :..|.|.|..|..:.
 Worm   104 KSMTSLVKELHNREVDMY-------RIIMRE-----KPACPTVNVLSLEAFTELSPLKAYIISEY 156

  Fly   148 VPQGYYVIRDRPVAQEELKTAFAKLAKWHAI--SMKYIKEQPDFLKEFKYGLFEMPTVKTDPFIT 210
            :|..::|..:..::.||:......:|.:.|:  ||...:::...:.|.              :|.
 Worm   157 IPNLHHVGMNDCISIEEIWAVVDGIAAFSAMGESMSEDEKKKSTIGEI--------------YIE 207

  Fly   211 TGMQSFIEMLDRLPE-LRK---------YKPHFEKIKDKYMQRLQAVMKEYHEN-RKSDAFY--- 261
            ..::.|.:  |:.|: :||         |:...|:..|.:  .|.....|..:| .:..||.   
 Worm   208 EAVKYFFD--DQSPDNMRKNLIMILGVAYEEKVEEAMDIF--DLYCGSSEIQKNYSRVSAFLGHS 268

  Fly   262 -VLCHGDFHLRNMMF---KNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGK 322
             ||.|.|....|::|   ..||    .|...|:|||.::|....:|:.......:..:.||.:..
 Worm   269 PVLMHSDIWPSNLLFSLSSENK----LEFKALIDFQTASLSSPGLDVGCLTVTCLSKKDRRTVQS 329

  Fly   323 DLINHYLTVLVATLKSIGYPGELP-TQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDL 386
            ::::.|....|.:||:   |..:| |:.:|.|.      |:....::.:.::..|.|.|.|:.:.
 Worm   330 EILDRYYKSFVKSLKT---PNSIPYTREQLEDS------YELCFPASVILMLPFILSFSVKLGEN 385

  Fly   387 IQDPETRQKTYFLDTYVKDVSKLLPKFEQLGYFKCL 422
            |.:....:....::..|...:..|.||.  |:||.|
 Worm   386 INEESVEKMAGLIEDLVTVHNSNLSKFP--GFFKNL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 60/277 (22%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 72/347 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.