DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and H06H21.8

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:397 Identity:83/397 - (20%)
Similarity:155/397 - (39%) Gaps:106/397 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AKGKFSRPLIIKAMPE-QDGHKK-----DMLSESHLFETEI----------------GMYCQVLP 112
            ||.|..|.|:..:.|| ::.|:|     :.|..:..|.:||                .::.:|..
 Worm     3 AKLKQLRRLVESSFPEIENFHEKVDASFEKLENAKSFWSEIYVAHLKVVGDGVKVPESVFIKVPR 67

  Fly   113 EFERILR---ESG----DDTKLFVP----CIYHSLE----PR----KVMIFEDL----------- 147
            ..|.:||   ||.    :|..|:..    ..|...|    |.    ||...||:           
 Worm    68 ISENVLRCEDESAVNHLNDVLLYYSKKENLFYKHFEYGSIPNFPFPKVYFTEDINGEATGGIVAE 132

  Fly   148 -VPQGYYVIRDRP-VAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFIT 210
             :.:..:.:...| :..|::......||..|:..||  ::...:::.|..|.....|      .:
 Worm   133 NLSEKVFAVEHIPGLKHEQILRLMEALAGLHSFLMK--RDDKSYVESFVEGAHGRET------FS 189

  Fly   211 TGMQS--FIEML---DRLPE------LRKYKPHFE-KIKDKYMQRLQAVMKEYHENRKSDAFY-- 261
            .|||:  |.|.|   :..||      :|..|..|: .||:|               ..:||..  
 Worm   190 EGMQNMMFEEALTLENVSPEVFGNDRIRNIKWSFDYSIKNK---------------ATADAISAF 239

  Fly   262 --VLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDL 324
              ::||.|.::.|:::|  |.:...|.:.::|:|:..:..|..|:...:.:.:..|.||:|.::.
 Worm   240 PGIICHADLNVTNVLWK--KDSAKDEISAIIDYQMLFIGSIAFDIIRVLTLGLNREIRRKMTQNY 302

  Fly   325 INHYLTVLVATLKSIGYPGELPTQAKLWDEIHK-NKYYDFFLLSTFLPLILAIKSKSFKVNDLIQ 388
            ::||...|.....     |:.|...:  :.:|: :..|.|....:...:.|.||..|   :..:.
 Worm   303 LDHYHKTLTELSN-----GKAPFSME--ELLHQYSLIYPFSSNFSLFGIALYIKMYS---DGTLG 357

  Fly   389 DPETRQK 395
            :||.:::
 Worm   358 NPEDKEE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 72/340 (21%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 44/207 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7662
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4083
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.