DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and E02C12.12

DIOPT Version :10

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_505432.2 Gene:E02C12.12 / 183991 WormBaseID:WBGene00017097 Length:200 Species:Caenorhabditis elegans


Alignment Length:129 Identity:31/129 - (24%)
Similarity:50/129 - (38%) Gaps:28/129 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 SIYMLMEPEQ-RREMGKDLINHY---------LTVLVATLKSIGYPG----ELPTQAKLWDEIHK 357
            ||..|:||:. ..|.||||...:         |.||...:|..|..|    :|....||..:.|.
 Worm    28 SIIALIEPDWIDVEKGKDLPKKFAVKISTQLALAVLSKIMKLGGENGFSEEKLNELGKLIRDGHN 92

  Fly   358 NKYYDFFLLSTF----LPLILAIKSKSFK-VNDLIQDPETRQKTYFLDTYVKDVSKLLPKFEQL 416
            .:...:.||...    :|.......|.:. .|||        |.:.:..::.:| :.:|.:|.:
 Worm    93 REVATYKLLEKMNHPDIPYTKVYGLKGYSDANDL--------KGFMIMEFIPNV-RSIPMYEAI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKL 52..341 CDD:397213 14/43 (33%)
E02C12.12NP_505432.2 Protein Kinases, catalytic domain 1..>200 CDD:473864 31/129 (24%)

Return to query results.
Submit another query.