DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and E02C12.10

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_505430.3 Gene:E02C12.10 / 183989 WormBaseID:WBGene00017095 Length:417 Species:Caenorhabditis elegans


Alignment Length:327 Identity:64/327 - (19%)
Similarity:117/327 - (35%) Gaps:98/327 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 QEELKT--------------AFAKLAKWHAISMKYIK-------EQPDFLKEFKYGLFEMPTVKT 205
            :|:|||              |:..|.|::...:.:.|       :..:.||.|....| :|.|.:
 Worm   100 EEKLKTFGNVTRECHNREVAAYKMLIKFNNSDIPFTKVYHLKPFDDANDLKGFMIMEF-IPNVHS 163

  Fly   206 DPF------------------------------ITTGMQSFIEML-DRLPELRKYKPHFEKIKDK 239
            .|.                              .:.|...||:|: :.:..:.:.:.||:.::..
 Worm   164 IPMYEAIPADDLISLVRGIATFAALGETSEGDKTSAGGPEFIDMMFEEVLSMDQIEGHFDSLRIL 228

  Fly   240 Y--------------MQRLQAVMKEYHENRKSDAF-YVLCHGDFHLRNMM-----FKNNKGTGAH 284
            |              :::.:.:.|:|.:..:...| .||.|||....||:     |.|.|...  
 Worm   229 YGSEHLNTVETSITILRQYRMITKKYTKISELLGFKLVLNHGDLWQSNMLHCLDEFGNLKLKA-- 291

  Fly   285 EDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQA 349
                ::|:|..:..|..:||:..:...:...:|||.|.:::..|.......|..     ||.:..
 Worm   292 ----IIDWQGVSTLPPGLDLSRLLMGCLSAHERRERGLEMLKLYHETFNQVLGK-----ELFSFQ 347

  Fly   350 KLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDLIQDPETRQKTYFLDTYVKDVSKLLPKFE 414
            :|.|..  |.||....: ..||::     .||..|..|.:.|..|      ..:|:...::...|
 Worm   348 ELQDSY--NLYYPMMAM-LLLPIV-----SSFLDNSPISEVEKSQ------ARIKNQKNMIAMME 398

  Fly   415 QL 416
            .|
 Worm   399 DL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 46/250 (18%)
E02C12.10NP_505430.3 DUF1679 3..408 CDD:369592 64/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.