DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31300 and C29F7.1

DIOPT Version :9

Sequence 1:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:279 Identity:61/279 - (21%)
Similarity:105/279 - (37%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLE------PRKVMIFE------- 145
            :.|..:..||...|        .:.|:. .|..:.||.||.:.:      |..|::.|       
 Worm    98 IMELFMHNTECNYY--------NVFRKY-TDLPMKVPVIYCAAKAGDAEAPVPVIVMEMFEDCTV 153

  Fly   146 -DLVPQGYYVIRDRPVAQEELKTAFAKLAKWHAISM---KYIKEQPDFLKEFKYGLFEMPTVKTD 206
             ||: .|:        .:::|.....::...|..|:   ::....||........||| ..||| 
 Worm   154 HDLI-DGF--------DKDQLFKIVDEIVNLHIFSLTTEEWRSVLPDSAMRDTVDLFE-AMVKT- 207

  Fly   207 PFITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKEYHENRKSDAFYVLCHGDFHLR 271
                     ..|.:.:.|.|.....:.||..||....:.....||.|.::..   ||.|||....
 Worm   208 ---------IAENMAKSPGLEIISKYIEKTFDKDPSFMTKFSDEYLEGKRKS---VLTHGDLWSP 260

  Fly   272 NMMF-KNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVAT 335
            .::: |::...|      ::|:|:.:......||...:......|.|.::.|.|::||...|.|.
 Worm   261 QILWDKDDNIAG------IIDWQVGHQGSPMEDLHRILSTGTSVENRNKLTKPLLDHYFEKLSAG 319

  Fly   336 LKSIGYPGELPTQAKLWDE 354
            |:..|.  ::|...:..||
 Worm   320 LEEKGV--KMPWTREEVDE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 57/264 (22%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 46/208 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.