DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31275 and Dynlrb2

DIOPT Version :10

Sequence 1:NP_732175.1 Gene:CG31275 / 326131 FlyBaseID:FBgn0063261 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_083573.1 Gene:Dynlrb2 / 75465 MGIID:1922715 Length:96 Species:Mus musculus


Alignment Length:77 Identity:28/77 - (36%)
Similarity:44/77 - (57%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IGYVVSDNTANAVAETSFDNTSAQAILKHLHGLLVSTCQSVVRDIDPSNKLCFMRLGTRKFEYLV 89
            ||.:|. |.......|:.||::.......||.|.:. .:|.||||||.|.|.|:|:.::|.|.:|
Mouse    18 IGTMVV-NAEGIPIRTTLDNSTTVQYAGLLHQLTMK-AKSTVRDIDPQNDLTFLRIRSKKHEIMV 80

  Fly    90 APEEYFTITVVQ 101
            ||::.:.:.|:|
Mouse    81 APDKEYLLIVIQ 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31275NP_732175.1 None
Dynlrb2NP_083573.1 Robl_LC7 3..93 CDD:397386 28/77 (36%)

Return to query results.
Submit another query.