DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31275 and CG10822

DIOPT Version :9

Sequence 1:NP_732175.1 Gene:CG31275 / 326131 FlyBaseID:FBgn0063261 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_611450.1 Gene:CG10822 / 37274 FlyBaseID:FBgn0034478 Length:114 Species:Drosophila melanogaster


Alignment Length:103 Identity:25/103 - (24%)
Similarity:47/103 - (45%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRILEKVIHQNGTIVDRILSEHTIGYVVSDNTANAVAETSFDNTSAQAILKH--LHGLLVSTCQ 63
            :..:..||..:.| :.|.::..|          :....:||.|.   |..|::  |:..|...||
  Fly    15 VEEVFRKVQEKPG-VEDILIMNH----------SGVPVKTSMDR---QEGLQYACLYDNLREKCQ 65

  Fly    64 SVVRDIDPSNKLCFMRLGTRKFEYLVAPEEYFTITVVQ 101
            :.:..::|:..|..:|:.|:..|.|:.|:...|:.|||
  Fly    66 AFLSKMEPAQNLTLLRVRTKYHEVLITPDAKITVLVVQ 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31275NP_732175.1 None
CG10822NP_611450.1 Robl_LC7 15..102 CDD:214939 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.