DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31275 and robl37BC

DIOPT Version :10

Sequence 1:NP_732175.1 Gene:CG31275 / 326131 FlyBaseID:FBgn0063261 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_609931.1 Gene:robl37BC / 35166 FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster


Alignment Length:44 Identity:17/44 - (38%)
Similarity:30/44 - (68%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LVSTCQSVVRDIDPSNKLCFMRLGTRKFEYLVAPEEYFTITVVQ 101
            ||...:|:|:|::..::|.::||.||:.|.:||.|...||.::|
  Fly    51 LVILARSMVQDLENGDELSYVRLRTRRQETMVATENEHTIILIQ 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31275NP_732175.1 None
robl37BCNP_609931.1 Robl_LC7 5..95 CDD:397386 17/44 (39%)

Return to query results.
Submit another query.