DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31272 and AT4G08878

DIOPT Version :9

Sequence 1:NP_650013.3 Gene:CG31272 / 326130 FlyBaseID:FBgn0051272 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_680668.1 Gene:AT4G08878 / 826464 AraportID:AT4G08878 Length:280 Species:Arabidopsis thaliana


Alignment Length:191 Identity:50/191 - (26%)
Similarity:84/191 - (43%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LNAVAYAGMTISAIAWGYLADTKGRKKILYWGYLIDAVCVFGSALSQN------FSMLVMFKFLG 158
            ::.||:||..:..|.:|.|.|..|||::.....||..:|...|:||..      ...|..|:|..
plant    55 VSGVAFAGTFLGQIFFGCLGDKLGRKRVYGLTLLIMTICSIASSLSFGKDPKTVMVTLCFFRFWL 119

  Fly   159 GLVVNG----PAAVLFTYLTEMHGPKHRSSVLMIVGMVTSTATVSLPLLAWGIFPRDWDFEFWGL 219
            |..:.|    .|.::|.|..:.......:||..:.| |...|...:.||...:|..::....:.|
plant   120 GFGIGGDYPLSATIMFEYANKRTRGAFIASVFAMQG-VGILAAGGVSLLVSYLFEIEFPSRAYIL 183

  Fly   220 Q---------VHSWQIFLFVLGIPSLISGLIFCSMPESPRF--LMAQGRNEEALQAFKQIY 269
            .         .:.|:|.|.|..:|:|::......|||:.|:  |:|:...:.||...|:|:
plant   184 DGAASTVPQADYVWRIILMVGALPALLTYYWRMKMPETARYTALVAKNAEQAALDMNKEIF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31272NP_650013.3 MFS 62..555 CDD:119392 50/191 (26%)
2A0115 74..524 CDD:273327 50/191 (26%)
AT4G08878NP_680668.1 MFS 13..>172 CDD:119392 32/117 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.