DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31272 and Med7

DIOPT Version :9

Sequence 1:NP_650013.3 Gene:CG31272 / 326130 FlyBaseID:FBgn0051272 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001098000.1 Gene:Med7 / 66213 MGIID:1913463 Length:233 Species:Mus musculus


Alignment Length:189 Identity:37/189 - (19%)
Similarity:66/189 - (34%) Gaps:52/189 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GLVVNGPAAVLFTYLTEMHGPKHRSSVLMIVGMVTSTATVSLPLLAWGI---FPRDWDF--EFWG 218
            ||....|..:..:|:  |.|.:.:...|:|           .||.:.||   .|..:|.  |...
Mouse    29 GLAPKPPPPIKDSYM--MFGNQFQCDDLII-----------RPLESQGIERLHPMQFDHKKELRK 80

  Fly   219 LQVHSWQIFLFVLGIPSLISGLIFCSMPESPRFLMAQGRNEEALQAFKQIYH-VNTRKPKDSYPI 282
            |.:.....||.:|.|           :..||..:..:.:.|:....|..::| :|..:|..:...
Mouse    81 LNMSILINFLDLLDI-----------LIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARET 134

  Fly   283 KALIQEVPNRKAAQNEVIYTIEEKSGEVPTKRQSRTLAESLRAGLQQMKPLVRKPLLGL 341
            ..::.||                      .|||....||..:..|:::..:::..|..|
Mouse   135 LRVMMEV----------------------QKRQRLETAERFQKHLERVIEMIQNCLASL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31272NP_650013.3 MFS 62..555 CDD:119392 37/189 (20%)
2A0115 74..524 CDD:273327 37/189 (20%)
Med7NP_001098000.1 Med7 7..164 CDD:368693 35/180 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..214
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0570
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.