DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31272 and Slc22a23

DIOPT Version :9

Sequence 1:NP_650013.3 Gene:CG31272 / 326130 FlyBaseID:FBgn0051272 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_072146.1 Gene:Slc22a23 / 64559 RGDID:620302 Length:689 Species:Rattus norvegicus


Alignment Length:412 Identity:88/412 - (21%)
Similarity:146/412 - (35%) Gaps:114/412 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GMTISAIAWGYLADTKGRKKILYWGYLIDAVCVFG--SALSQNFSMLVMFKFLGGLVVNGPAAVL 169
            |:....:..|.:||..||:.:|.:..:.  :.:||  .|||.|.:|....:|..|..:.|....|
  Rat   234 GLIFGYLITGCIADWVGRRPVLLFSVIF--ILIFGLTVALSVNVTMFSTLRFFEGFCLAGIILTL 296

  Fly   170 FTYLTEMHGPKHRSSVLMIVGMVTSTATVSLPLLAWGIFPRDWDFEFWGLQVHSWQIFLFVLGIP 234
            :....|:..|..|..:.|:...|.......:|.||  ...||            ||:...::..|
  Rat   297 YALRIELCPPGKRFIITMVASFVAMAGQFLMPGLA--ALCRD------------WQVLQALIICP 347

  Fly   235 SLISGLIFCSMPESPRFLMAQGRNEEALQAFKQIYHVN-------------------TRKPKDSY 280
            .|:..|.:...|||.|:|||..:.|.|.:....:...|                   :|:||.  
  Rat   348 FLLMLLYWSIFPESLRWLMATQQFESAKKLILYLTQKNCVSPESDIKGVMPELEKELSRRPKK-- 410

  Fly   281 PIKALIQEVPNRKAAQNEVIYTIEEKSG----------------EVPTKRQSRTLAESLRAGLQQ 329
              ..:::.|..|...:|.|:..:...:|                :||       |.|:..|....
  Rat   411 --VCIVKVVGTRNLWKNIVVLCVNSLTGYGIHHCFARSMMGHEVKVP-------LLENFYADYYT 466

  Fly   330 MKPLVRKPLLGLAIC---CYVMQF-----GIFLGM------NTIRLWLPQLFASMAEYEALHAGD 380
            |..      :.||.|   |.|::|     |:.|.|      :.::|.|..|....::    |...
  Rat   467 MAS------IALASCLAMCLVVRFLGRRGGLLLFMILTALASLLQLGLLNLIGKYSQ----HPDS 521

  Fly   381 GLDVSMCTILEFSVNQTAETALNYADACSEPKVISMDMYLNNIIVSATGFVGYFFAGGI----LR 441
            .|.:.:...:..||......|.:.           :.|:.::    |.|.:..||...|    :|
  Rat   522 ELQLKLAVGMSDSVKDKFSIAFSI-----------VGMFASH----AVGSLSVFFCAEITPTVIR 571

  Fly   442 ALGPKRMMTYGLFL-SGTFGLM 462
            ..|      .||.| |..||::
  Rat   572 CGG------LGLVLASAGFGML 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31272NP_650013.3 MFS 62..555 CDD:119392 88/412 (21%)
2A0115 74..524 CDD:273327 88/412 (21%)
Slc22a23NP_072146.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..188
MFS_SLC22A23 187..608 CDD:341002 88/412 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.