DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31272 and MED7

DIOPT Version :9

Sequence 1:NP_650013.3 Gene:CG31272 / 326130 FlyBaseID:FBgn0051272 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_731500.1 Gene:MED7 / 41288 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster


Alignment Length:174 Identity:33/174 - (18%)
Similarity:59/174 - (33%) Gaps:41/174 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 SMPESPRFLMAQGRNEEALQAFKQIYHVNTRKPKDSYPIKALIQEVPNRKAAQNEV--IYTIEEK 306
            |:|..|...:|...:|...:         .|.|:            |....||:||  ::.|:..
  Fly    10 SLPMPPERYIANYTDENIRR---------NRAPR------------PPPPPAQHEVYSMFGIQYN 53

  Fly   307 SGEVPTKRQSRTLAESLRAGLQQMKPLVRKPLLGLAICCYVMQFGIFLGMN-----------TIR 360
            :.|:....:|:.:...:.....:.|.|.:   |..::....:....||.:|           .|.
  Fly    54 NDEMIRSLESQNIKRLIPIHFDRRKELKK---LNHSLLVNFLDLIDFLILNPDSPRRTEKIDDIS 115

  Fly   361 LWLPQLFASMAEYEALHAGDGLDVSMCTILEFSVNQTAETALNY 404
            |....:...:.|:....|.:.|.|.|    |....|..|||..:
  Fly   116 LLFVNMHHLLNEFRPHQARETLRVMM----EMQKRQRVETAARF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31272NP_650013.3 MFS 62..555 CDD:119392 33/174 (19%)
2A0115 74..524 CDD:273327 33/174 (19%)
MED7NP_731500.1 Med7 8..166 CDD:283604 33/174 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0570
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.