DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31272 and T05A1.5

DIOPT Version :9

Sequence 1:NP_650013.3 Gene:CG31272 / 326130 FlyBaseID:FBgn0051272 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:285 Identity:61/285 - (21%)
Similarity:111/285 - (38%) Gaps:64/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FGIFNLMLLIVSIPAQSAAIFESSS------MSYILPIAECDLRLTLEDKG-VLNAVAYAGMTIS 111
            |.:..|.||.| :|..|.:....||      .|::....|.::..||.|.| :.:::.:.|..|.
 Worm    88 FSMAFLWLLSV-MPTMSPSYMAPSSPCTLDNCSFVTVQNEFNITKTLIDPGEMTSSIFFLGNGIL 151

  Fly   112 AIAWGYLADTKGRKKILYWGYLIDAVCVFGSALSQNFSMLVMFKFLGGLVVNGPAAVLFTYLTEM 176
            ...:...||..||:.:|.....|..:...|:|.:..|.::::.:|..|        ..||.||.:
 Worm   152 GQIYAVAADRIGRRPVLIASLFISGLSGIGAAYAPTFEIMLIGRFFQG--------SCFTALTMI 208

  Fly   177 -------------HGPKHRSSVLMIVGMVTSTATVSLPLLAWGIFPRDWDFEFWGLQVHSWQIFL 228
                         ||   .:|||..:..|....:|| ||               .:...:|:...
 Worm   209 NWVMCCESISFSGHG---YASVLFGLCWVIGYCSVS-PL---------------AMYFSTWRYVQ 254

  Fly   229 FVLGIPSLISG-LIFCSMPESPRFLMAQGR---------------NEEALQAFKQIYHVNTRKPK 277
            ....:|.::.| |:..::|||..||:|:.:               |||......||..:::|:..
 Worm   255 LATSVPCVLFGILMMFTLPESFSFLVAKRKRDDLVKWIEMASRVGNEEIDYDADQIVDMSSREED 319

  Fly   278 DSYPIKALIQEVPNRKAAQNEVIYT 302
            :...::.|...:.::....|..:.|
 Worm   320 NESLLQTLKLVLQSKLMVTNTAVET 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31272NP_650013.3 MFS 62..555 CDD:119392 58/277 (21%)
2A0115 74..524 CDD:273327 54/265 (20%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 37/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.