DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hang and zbtb12.1

DIOPT Version :9

Sequence 1:NP_001138204.1 Gene:hang / 32613 FlyBaseID:FBgn0026575 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_001038352.1 Gene:zbtb12.1 / 559143 ZFINID:ZDB-GENE-060503-875 Length:483 Species:Danio rerio


Alignment Length:475 Identity:98/475 - (20%)
Similarity:159/475 - (33%) Gaps:159/475 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   672 KCEGGGYDYDNPEQYRPLLTRDKVEFIEQNDEFLEQYQTMTCRCCNKYFSTYKNFMAHVRKKYPQ 736
            ||.|....|..|:...|:||.:|            ..||                          
Zfish   117 KCRGALSQYMQPQSCSPVLTSNK------------SVQT-------------------------- 143

  Fly   737 LPRNLCFNCLKMNDSKAL-FISHLKKRNCINLFRVLNALRGKTTTVVVPIADDVADDGATGSIPV 800
                     :|.:||::: .|..::..:..:||...:........|::...:...|         
Zfish   144 ---------VKSDDSESMPVIVSVRGSDSSSLFETEDGYGSDVYQVIIDEPEKTPD--------- 190

  Fly   801 ADAGAGVVAMNSPTVTASGEVVTPGGGSERPE-KLRAK--ELLVNKLYECKLCPKGFRTKHEFRT 862
                    |......|||.::.....|.|.|. :::||  :|...:.|..:   ||.:.:...|.
Zfish   191 --------AEEENRETASEDLCQLDMGIEEPNMEVQAKYDDLHGEQQYSER---KGIKGRGLKRR 244

  Fly   863 HVYDKHADVQRKDNNSI---QCSFCGLDFADPVDRRRHYNNMDCIVRLRCMTCDAKLETHQRFLD 924
            ..|     |.:||..|:   |.::|             :...:.|:........|..:::||..|
Zfish   245 KRY-----VFKKDRTSLGNYQDNWC-------------FQTAEEIMGKSETDFQADYQSNQRLTD 291

  Fly   925 ---HVYQDHLGGVGGGAVSDNASTTGSGMARSNSMEHSPGKRSLLGALGVGSSAEESRSSSAAPP 986
               |....:.||.|    .|..|..|....|   :|.|.|:..    ||:|:.:.| |.::....
Zfish   292 CSVHTEYKNEGGPG----EDIGSDGGPAHFR---IEASSGEEE----LGIGTPSNE-RGATDESV 344

  Fly   987 LTSTPKLAGG---NQVGGGGSTSASAAAAAQSSANRDASAPKSQYFSRMPQVCPICGQQYNNYNN 1048
            :.||..:.|.   .|.|       .|.::.|..|....|| ..||      :||.|.:|::|..|
Zfish   345 VGSTSNVTGPVVCEQCG-------LAFSSTQDLAMHSLSA-HQQY------ICPCCRKQFSNSRN 395

  Fly  1049 VLRHMESKHPN-KLP-------------------------ETYKCVRCGLGYPRISYLREHMINV 1087
            :.|||.....| :||                         ..|.|..|.:.:...|.||.|::..
Zfish   396 LNRHMLLHRDNSRLPSCPLCHKTFTQKSTMYDHMNVHSGERPYVCAYCPISFAHRSALRRHLLEQ 460

  Fly  1088 HG---------VDKNRHSGG 1098
            ||         :.:|:||.|
Zfish   461 HGKTMPQNHQEMQRNKHSIG 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hangNP_001138204.1 zf-AD 80..154 CDD:285071
C2H2 Zn finger 1036..1057 CDD:275368 9/20 (45%)
C2H2 Zn finger 1067..1088 CDD:275368 6/20 (30%)
C2H2 Zn finger 1279..1298 CDD:275371
C2H2 Zn finger 1308..1325 CDD:275371
C2H2 Zn finger 1420..1440 CDD:275368
C2H2 Zn finger 1450..1468 CDD:275368
zbtb12.1NP_001038352.1 BTB 21..122 CDD:279045 3/4 (75%)
BTB 32..125 CDD:197585 3/7 (43%)
C2H2 Zn finger 357..378 CDD:275368 7/28 (25%)
C2H2 Zn finger 383..403 CDD:275368 9/19 (47%)
C2H2 Zn finger 412..432 CDD:275368 0/19 (0%)
zf-H2C2_2 428..449 CDD:290200 3/20 (15%)
C2H2 Zn finger 440..457 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.