DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hang and Sry-delta

DIOPT Version :9

Sequence 1:NP_001138204.1 Gene:hang / 32613 FlyBaseID:FBgn0026575 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:493 Identity:109/493 - (22%)
Similarity:167/493 - (33%) Gaps:135/493 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1174 CPICNAVFSNNIGLSNHMR----------SHYTAS-------NAVNAAL---------------- 1205
            |..|.||..::.|.|:.||          |..|.|       |.:...|                
  Fly     4 CFFCGAVDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQEL 68

  Fly  1206 -----AAANRM-TPKSLTITATPATDSELGVGGTMSESAPATPANVPPAMANQTPQEQAVFRRSL 1264
                 ...|.| |.|.||.....|..||..|           |.:....:..:....|:......
  Fly    69 SDYDTIMVNLMTTQKRLTTQLKGALKSEFEV-----------PESGEDILVEEVEIPQSDVETDA 122

  Fly  1265 DQAADRRFRRMRCRICQRRFSSKKSYRYHMLTDHQVQ----NVQFIKCK---LCNAEFAYEKGLK 1322
            |..||..|    ..:.:.:..|....:...:.:.:.:    :.:|| |:   :.::|..|.|   
  Fly   123 DAEADALF----VELVKDQEESDTEIKREFVDEEEEEDDDDDDEFI-CEDVDVGDSEALYGK--- 179

  Fly  1323 VHLFKVHGKAIKDEMIIKQFECDVCSIVYSSESELQQHKRSVHKLTSASASTSASTSSKIDDDSL 1387
                ...|:....:..:|| ||..|..||:|..:||:|....|   |...:........|..|  
  Fly   180 ----SSDGEDRPTKKRVKQ-ECTTCGKVYNSWYQLQKHISEEH---SKQPNHICPICGVIRRD-- 234

  Fly  1388 MDDGKPTSSDLADLSTLAAGGSTASAPLYWYQCKYCPSNFNTNKKLAIHINSHDEFDSNDYSCKD 1452
                    .:..:|......|.|..      ||:|||.:|:.......|:..|  :|...|.|:.
  Fly   235 --------EEYLELHMNLHEGKTEK------QCRYCPKSFSRPVNTLRHMRMH--WDKKKYQCEK 283

  Fly  1453 CGNVYSGRKSLWVHRYKKHPQVPNPAECSLCRKVFFDRQMHDNHT-------PT--CNRKPITST 1508
            ||..:|....|:.||. :|....||..||:|...|..|:..::||       |.  |:..|    
  Fly   284 CGLRFSQDNLLYNHRL-RHEAEENPIICSICNVSFKSRKTFNHHTLIHKENRPRHYCSVCP---- 343

  Fly  1509 GAHQQQDGQLHSHHTAKRTIFRH-KTGDDD------DEEDDDEQQQLEE-RANSDGNGTTVGV-A 1564
                       ...|.:.|:..| ||.:.|      :|...||||.:|| ..:.|.:...|.| .
  Fly   344 -----------KSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVEELHVDVDESEAAVTVIM 397

  Fly  1565 SGSTAAAGTSLKIRIPEVACTICGARFTDQEHFSKHIQ 1602
            |.:...:|          .|.||...|.:::....|:|
  Fly   398 SDNDENSG----------FCLICNTNFENKKELEHHLQ 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hangNP_001138204.1 zf-AD 80..154 CDD:285071
C2H2 Zn finger 1036..1057 CDD:275368
C2H2 Zn finger 1067..1088 CDD:275368
C2H2 Zn finger 1279..1298 CDD:275371 1/18 (6%)
C2H2 Zn finger 1308..1325 CDD:275371 4/19 (21%)
C2H2 Zn finger 1420..1440 CDD:275368 6/19 (32%)
C2H2 Zn finger 1450..1468 CDD:275368 6/17 (35%)
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 46/191 (24%)
C2H2 Zn finger 225..245 CDD:275368 3/29 (10%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
C2H2 Zn finger 310..327 CDD:275370 5/16 (31%)
zf-C2H2 337..359 CDD:278523 6/36 (17%)
C2H2 Zn finger 339..359 CDD:275368 6/34 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.