DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hang and CG12942

DIOPT Version :9

Sequence 1:NP_001138204.1 Gene:hang / 32613 FlyBaseID:FBgn0026575 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_610628.2 Gene:CG12942 / 36158 FlyBaseID:FBgn0033569 Length:686 Species:Drosophila melanogaster


Alignment Length:571 Identity:105/571 - (18%)
Similarity:172/571 - (30%) Gaps:232/571 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   997 NQVGGGGSTSASAAAAAQSSANR-DASAP-------KSQYFSRMPQV-CPICGQQYNNYNNVLRH 1052
            |..|...|....|:...|..:|. :.|:|       .|.....:|.: |.||...:.:...:..|
  Fly   258 NDDGCSQSPKNEASNETQLKSNGIEVSSPLFIKLATTSSTTGNIPILKCNICQYTHTDAEQLKIH 322

  Fly  1053 MESKHPNKLPE----------TYKCVRCGLGYPRISY-------LREHMINVHGVDKNRHSGGFE 1100
            .:|.|...:.|          .:||..|.      ||       :::|:|:.|.:|     |.||
  Fly   323 YKSIHKISMMEDDIIGLNKNQNFKCRPCN------SYETKDRSEMQKHLIDHHKID-----GDFE 376

  Fly  1101 YIVNADAVKLADGSTPNVYTGRYDYVMKDLMSITNGGTLDDEEEEPGSVAKKMRLDDSSNNSSLV 1165
                                 .|.|:                                       
  Fly   377 ---------------------MYCYM--------------------------------------- 381

  Fly  1166 GVASQQKECPICNAVFSNNIGLSNHMRSHYTASNAVNAALAAANRMTPKSLTITATPATDSELGV 1230
                 |..||.|:.:|.:    ....|.|||..:            ||..:.::.|         
  Fly   382 -----QANCPACDRIFKD----QRSARKHYTRVH------------TPVQIAVSPT--------- 416

  Fly  1231 GGTMSESAPATPANVPPAMANQTPQEQAVFRRSLDQAADRRFRRMR----CRICQRRFSSKKSYR 1291
                 ||...|..:             .||.:.....:.:||.:::    |..|.::|:|.:.|.
  Fly   417 -----ESYACTACD-------------KVFNQKASLHSHQRFCQVKDVVHCSFCDQQFNSMRKYE 463

  Fly  1292 YHMLTDHQVQNVQFIKCKLCNAEFAYEKGLKVHLFKVHGKAIKDEMIIKQFECDVCSIVYSSESE 1356
            .|:...|.|:.|.  :|::|...|...:.|.:|. |.|.:        :.::|..||:.|.:.:|
  Fly   464 LHLQQLHAVETVH--ECEICRRSFKSAETLTMHR-KRHSE--------RHYQCGKCSLNYVNSAE 517

  Fly  1357 LQQHKRSVHKLTSASASTSASTSSKIDDDSLMDDGKPTSSDLADLSTLAAGGSTASAPLYWYQCK 1421
            |:.|....|                ::::       |.|                        |.
  Fly   518 LRVHYERAH----------------VNEE-------PVS------------------------CL 535

  Fly  1422 YCPSNFNTNKKLAIH-INSHDEFDSNDYSCKDCGNVYSGRKSLWVHRYKKHPQVPNPAECSLCRK 1485
            .|.:.|.....|..| ..||.:  |..:.|:.|.   ...|:.|..|..::..:..|.:|..|..
  Fly   536 TCGNQFQNMTLLREHEQRSHQK--SKVWRCEVCN---FETKTRWRRRQHQYEHMDYPYKCQKCTS 595

  Fly  1486 VFFDRQMHDNHTPTCNRKPITSTGAH--QQQDGQLHSHHTAKRTIFRHKTG 1534
            .|.||.....|          |...|  :..|.||       ..:||.|.|
  Fly   596 EFADRSKFRQH----------SKKVHGIELSDEQL-------AEMFREKKG 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hangNP_001138204.1 zf-AD 80..154 CDD:285071
C2H2 Zn finger 1036..1057 CDD:275368 5/20 (25%)
C2H2 Zn finger 1067..1088 CDD:275368 6/27 (22%)
C2H2 Zn finger 1279..1298 CDD:275371 5/18 (28%)
C2H2 Zn finger 1308..1325 CDD:275371 4/16 (25%)
C2H2 Zn finger 1420..1440 CDD:275368 5/20 (25%)
C2H2 Zn finger 1450..1468 CDD:275368 4/17 (24%)
CG12942NP_610628.2 zf-AD 22..101 CDD:285071
C2H2 Zn finger 385..406 CDD:275368 8/24 (33%)
C2H2 Zn finger 421..470 CDD:275368 11/61 (18%)
C2H2 Zn finger 449..466 CDD:275371 5/16 (31%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 505..526 CDD:275368 7/20 (35%)
C2H2 Zn finger 534..555 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.