DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hang and az2

DIOPT Version :9

Sequence 1:NP_001138204.1 Gene:hang / 32613 FlyBaseID:FBgn0026575 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:684 Identity:128/684 - (18%)
Similarity:239/684 - (34%) Gaps:191/684 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   897 HYNNMDCIVRLRCMTCDAKLETHQRFLDHVYQDHLGGVGGGAVSDNAS-----TTGSGMARSNSM 956
            |.|  ||.|.:       :.:..:.|:.|| ::||        ..|.|     ||...::.:...
  Fly    22 HQN--DCYVEM-------EFKRWREFIVHV-KEHL--------EANPSMQQELTTSEVISSAKCE 68

  Fly   957 EH-SPGKRSLLGALGVGSSAEESRSSSAA-------PPLT----STPKLAGGNQVGGGGSTSASA 1009
            |. ||.|..::         ||...:..|       ||.:    ||..:....:......:|:..
  Fly    69 EEVSPAKVFIV---------EEPPENCLAEDMFVDVPPSSENDESTSPVEEEEEEDDEVDSSSMT 124

  Fly  1010 AAAAQSSANRDASAPKSQ----YFSRMPQVCPI-------------CGQQY-------NNYNNVL 1050
            ......:.|....||.::    ::.|.|::...             ..:.|       |.|..:|
  Fly   125 VDCELGTRNSTHFAPLTKFNPTFYRRSPRITQFIELYKQQTCLWDPADESYRDKEKRANAYEELL 189

  Fly  1051 RHMESKHPNKLPETYKCVRCGLGYPRISYLREHMINVHGVDKNRHSGGFEYIVNADAVKLADGST 1115
            ..:::. .|.....||..:|      |:.|.....::....|.:              ||.  ..
  Fly   190 EQLKAT-VNLHLTAYKLKKC------ITSLHAQYASISRQKKTQ--------------KLT--KV 231

  Fly  1116 PNVYTGRYDYVMKDLMSITNGGTLDDEEEEPGSVAKKMRLDDSSNNSSLVGVASQQKECP----- 1175
            |..|.|:|.:       :...|:|:|.:.:......|::|..:..|...........:.|     
  Fly   232 PLYYHGKYSF-------LAERGSLEDADSDDVDGDGKIKLVFTEENQLTTQFIDLYSKFPQLYDP 289

  Fly  1176 ----ICNAVF--SNNIGLSNHMRS--------HYTASNAVNAALAAANRMTPKSLTITATPATDS 1226
                .||...  |:.|.:::.:.|        ||...:::.:.....:|.. |:|       ||.
  Fly   290 AHKHFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRI-KTL-------TDV 346

  Fly  1227 ELGVGGTMSESAPATPANVPPAMANQTPQEQAVFRRSLDQAADRRFR-RMRCRICQRRFSSKKSY 1290
            :. ||.:::                    |:....|.......:.|| :::|.:|:..||:..:.
  Fly   347 QC-VGLSLA--------------------EKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHAL 390

  Fly  1291 RYHMLTDHQVQNVQFIKCKLCNAEFAYEKGLKVHLFKVHGKAIKDEMIIKQFECDVCSIVYSSES 1355
            :.|...||::.:..:.:|.||...|..:..|:.|..:||        :.|.|.|::||..::..:
  Fly   391 QAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVH--------MDKSFVCEICSRSFAFGN 447

  Fly  1356 ELQQHKRSVHKLTSASASTSASTSSKIDDDSLMDD------GKPTSSDLADLSTLAAGGSTASAP 1414
            :|..|||: |                 |:..:...      ||.....:...:.:.|..:...| 
  Fly   448 QLAIHKRT-H-----------------DEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKIRA- 493

  Fly  1415 LYWYQCKYCPSNFNTNKKLAIHINSHDEFDSNDYSCKDCGNVYSGRKSLWVHRYKKHPQVPNPAE 1479
               ::|..||.:|.|.:.|..|:.:|  .:..|..|:.|...::...:|..||   |.......:
  Fly   494 ---FKCDMCPKDFLTKRDLKDHVKAH--LNIRDKVCEVCQKAFTNANALVKHR---HIHKEKTLQ 550

  Fly  1480 CSLCRKVFFDR---QMHDNHTPTCNRKPITSTGA 1510
            ||||...|.:|   .:|...|....:..::|:.|
  Fly   551 CSLCTTRFSERVSLGVHMRRTHKILKSSLSSSDA 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hangNP_001138204.1 zf-AD 80..154 CDD:285071
C2H2 Zn finger 1036..1057 CDD:275368 4/40 (10%)
C2H2 Zn finger 1067..1088 CDD:275368 3/20 (15%)
C2H2 Zn finger 1279..1298 CDD:275371 4/18 (22%)
C2H2 Zn finger 1308..1325 CDD:275371 5/16 (31%)
C2H2 Zn finger 1420..1440 CDD:275368 7/19 (37%)
C2H2 Zn finger 1450..1468 CDD:275368 4/17 (24%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 17/114 (15%)
GT1 276..>341 CDD:304916 9/65 (14%)
C2H2 Zn finger 377..398 CDD:275368 5/20 (25%)
C2H2 Zn finger 408..429 CDD:275368 6/20 (30%)
C2H2 Zn finger 436..456 CDD:275368 7/20 (35%)
C2H2 Zn finger 467..488 CDD:275368 3/20 (15%)
C2H2 Zn finger 496..516 CDD:275368 7/19 (37%)
C2H2 Zn finger 524..544 CDD:275368 6/22 (27%)
C2H2 Zn finger 551..572 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.