DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hang and CG7101

DIOPT Version :9

Sequence 1:NP_001138204.1 Gene:hang / 32613 FlyBaseID:FBgn0026575 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster


Alignment Length:428 Identity:85/428 - (19%)
Similarity:139/428 - (32%) Gaps:148/428 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1258 AVFRRSL-----DQAADRRFRRM-RCRICQRRFSSKKSYRYHMLTDHQVQNVQFIKCKLCNAEFA 1316
            |.|.|.|     :|....|.||: .|..|...|..:.....|....|  .:.||: |..|..::|
  Fly    39 AEFSRHLAAKRHEQQCSVRVRRLFVCPHCLTLFGEEARLERHRERKH--NDGQFL-CLQCGKKYA 100

  Fly  1317 YEKGLKVHLFKVHGKAIKDEMIIKQFECDVCS------IVYSSESELQQHKRSVHKLTSASASTS 1375
            ....|..|:...||:.       ..|.||:|:      ..:|...|||:|...||:|.:.. ||:
  Fly   101 SATFLYRHVASWHGQQ-------SLFYCDMCTDNCNDVKTFSGMLELQEHAEEVHRLRTLK-STA 157

  Fly  1376 ASTSSKIDDDSLMDDGKPTSSDLADL-------STLAAGGST--------ASAPLYWYQCKYCPS 1425
            :...|::|:   |:|.:....::.::       ..|..|..|        .:|....:.|.:|.:
  Fly   158 SDADSQVDE---MEDLEMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAKPSVFVCPFCAN 219

  Fly  1426 NFNTNKKLAIHINSHDEFDSNDYSCKDCGNVYSGRKSLWVHRYKKHPQVPNPAECSLCRKVFFDR 1490
            .|..:..|..|:....|..:.|  |..||..:..|::|..|..:.|..:.... |.:|:..|   
  Fly   220 GFPGSLSLVRHLEQVHERSALD--CCYCGKSHGSREALRSHLQRVHILLRGHV-CGICQADF--- 278

  Fly  1491 QMHDNHTPTCNRKPITSTGAH-QQQDGQLHSHHTAKRTIFRHKTGDDDDEEDDDEQQQLEERANS 1554
                            :|..| ::....||..|.                               
  Fly   279 ----------------ATADHLKKHVNSLHLDHR------------------------------- 296

  Fly  1555 DGNGTTVGVASGSTAAAGTSLKIRIPEVACTICGARFTDQEHFSKHIQKHEQELYVDNPLAAMFD 1619
                                     |.: |..||.|||.:.|.:.||                  
  Fly   297 -------------------------PHL-CPTCGKRFTQRCHLTDHI------------------ 317

  Fly  1620 DGPADAGQFQVERQNENGEYACDLCAKTFPQVIALKVH 1657
                     :.:|.:.:|.|.|:.|.:.|.:.|.|:.|
  Fly   318 ---------KTDRGHGHGTYTCEFCVRPFFRAIDLERH 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hangNP_001138204.1 zf-AD 80..154 CDD:285071
C2H2 Zn finger 1036..1057 CDD:275368
C2H2 Zn finger 1067..1088 CDD:275368
C2H2 Zn finger 1279..1298 CDD:275371 3/18 (17%)
C2H2 Zn finger 1308..1325 CDD:275371 4/16 (25%)
C2H2 Zn finger 1420..1440 CDD:275368 5/19 (26%)
C2H2 Zn finger 1450..1468 CDD:275368 6/17 (35%)
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 13/54 (24%)
C2H2 Zn finger 242..263 CDD:275368 6/20 (30%)
C2H2 Zn finger 271..292 CDD:275368 5/39 (13%)
C2H2 Zn finger 300..319 CDD:275368 9/45 (20%)
C2H2 Zn finger 330..347 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.