DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hang and CG3032

DIOPT Version :9

Sequence 1:NP_001138204.1 Gene:hang / 32613 FlyBaseID:FBgn0026575 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:457 Identity:91/457 - (19%)
Similarity:141/457 - (30%) Gaps:174/457 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1020 DASAPKSQYFSRMPQVCPICGQQYNNYNNVLRHMESKHP-NKLPETYKCVRCGLGYPRISYLREH 1083
            |.|..||...||....|.:|.:.:.:...:..|:...|. :|.|  ::|.:|...|..:..|..|
  Fly   142 DKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRP--FQCDQCEKAYSFMGGLYTH 204

  Fly  1084 MINVHGVDKNRH---SGGFEYIVNADAVKLADGSTPNVYTGRYDYVMKDLMSITNGGTLDDEEEE 1145
            :..||...:.||   ..|.|                .:||.|.                      
  Fly   205 IREVHAPKERRHPCDQPGCE----------------RIYTSRI---------------------- 231

  Fly  1146 PGSVAKKMRLDDSSNNSSLVGVASQQKECPICNAVFSNNIGLSNHMRSHYTASNAVNAALAAANR 1210
              ::.|..||..|..:..    |.::..|..|.|.|:.:..|..|:::.:...:.|.|.      
  Fly   232 --AMQKHKRLKHSPRDRD----ALKKFICEQCGASFNQSANLKYHLKTKHPTEDEVAAR------ 284

  Fly  1211 MTPKSLTITATPATDSELGVGGTMSESAPATPANVPPAMANQTPQEQAVFRRSLDQAADRRFRRM 1275
                               .||                                  |.:|.|   
  Fly   285 -------------------EGG----------------------------------AGERHF--- 293

  Fly  1276 RCRICQRRFSSKKSYRYHMLTDHQVQNVQFIKCKLCNAEFAYEKGLKVHLFKVHGKAIKDEMIIK 1340
             |.|||:.|.|:.:.:||.|..|:||.....:|::|....|.:..|..|:. :|..        .
  Fly   294 -CDICQKEFHSRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHML-MHSN--------D 348

  Fly  1341 QFECDVCSIVYSSESELQQHKRSVH-KLTSASASTSASTSSKIDDDSLMDDGKPTSSDLADLSTL 1404
            :..|:.|...::...||:.|.|:|| ||                        ||           
  Fly   349 KLPCEHCGRRFARRFELEAHVRAVHLKL------------------------KP----------- 378

  Fly  1405 AAGGSTASAPLYWYQCKYCPSNFNTNKKLAIHINSHDEFDSNDYSCKDCGNVYSGRKSLWVHRYK 1469
                         :.|.:||.:|.:.|.|..|...|.  ....|.|..||..:..:..|..|| |
  Fly   379 -------------FPCHHCPESFASRKTLRHHEYIHT--GEKPYICDTCGQAFRQQTCLKNHR-K 427

  Fly  1470 KH 1471
            .|
  Fly   428 VH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hangNP_001138204.1 zf-AD 80..154 CDD:285071
C2H2 Zn finger 1036..1057 CDD:275368 3/20 (15%)
C2H2 Zn finger 1067..1088 CDD:275368 5/20 (25%)
C2H2 Zn finger 1279..1298 CDD:275371 8/18 (44%)
C2H2 Zn finger 1308..1325 CDD:275371 4/16 (25%)
C2H2 Zn finger 1420..1440 CDD:275368 7/19 (37%)
C2H2 Zn finger 1450..1468 CDD:275368 5/17 (29%)
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 3/20 (15%)
C2H2 Zn finger 188..209 CDD:275368 5/20 (25%)
C2H2 Zn finger 218..239 CDD:275368 6/60 (10%)
C2H2 Zn finger 254..275 CDD:275368 6/20 (30%)
C2H2 Zn finger 294..315 CDD:275368 9/20 (45%)
C2H2 Zn finger 325..345 CDD:275368 5/20 (25%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
C2H2 Zn finger 409..429 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.