DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hang and C04F5.9

DIOPT Version :9

Sequence 1:NP_001138204.1 Gene:hang / 32613 FlyBaseID:FBgn0026575 Length:2223 Species:Drosophila melanogaster
Sequence 2:NP_504371.1 Gene:C04F5.9 / 178899 WormBaseID:WBGene00015451 Length:534 Species:Caenorhabditis elegans


Alignment Length:354 Identity:73/354 - (20%)
Similarity:118/354 - (33%) Gaps:94/354 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1030 SRMPQVCPICGQQYNNYNNVLRHMESKHPNKLPETYKCVRCGLGYPRISYLREHMINVHGVDKNR 1094
            |.:|.||.:||..:....::..|..          :||......:|....:....:||       
 Worm   148 SVVPYVCDLCGFGFRYKKSLYNHWR----------HKCTEVLAHFPDGGNIENQELNV------- 195

  Fly  1095 HSGGFEYIVNADAVKLADGSTPNVYTGRYDYVMKDLMSITNGGTLDDEEEEPGSVAKKMRLDDSS 1159
                    :..|.||.|:...|.....:.|  .:|:....:|...||||..|...|....|....
 Worm   196 --------MVEDLVKRAEVINPIELPSKRD--GEDIEKEDSGDIDDDEETSPYFTAPITALSFDL 250

  Fly  1160 NNSSLVGVASQQKECPICNAVFSNNIGLSNHMRS-HYTASNAVNAALA----AANRMTPKSLTIT 1219
            .:.::..|:|.: |||.||..|.:...|..|..: |.||.......|.    |.||:....|...
 Worm   251 QDWNVENVSSTE-ECPKCNRYFHSLGRLDQHTHAFHGTARPGFVCKLCRMKFAENRILLAHLRSG 314

  Fly  1220 ATPATDSELGVGGTMSESAPATPANVPPAMANQTPQEQAVFRRSLDQAADRRFRRMRCRICQRRF 1284
            ..|                          |..:.|.|             ::.::|......:..
 Worm   315 CKP--------------------------MRVEVPDE-------------KKRKKMSAEELMKVV 340

  Fly  1285 SSKKSYRYHMLTDHQVQNVQFIKCKLCNAEFAYEKGLKVHLFKVHGKAIKD------------EM 1337
            .::||....:..:.:..|::|||      ||..:    :...|.||.|...            |:
 Worm   341 ENEKSTWIELFENKKAANLKFIK------EFLDQ----IDRRKPHGYASSQIVLNRPVPAHSIEI 395

  Fly  1338 IIKQFECDVCSIVYSSESELQQHKRSVHK 1366
            ..|...|.:|.|.:.|...|.||:::||:
 Worm   396 DTKMNSCRLCKITFKSSRFLYQHEQTVHQ 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hangNP_001138204.1 zf-AD 80..154 CDD:285071
C2H2 Zn finger 1036..1057 CDD:275368 4/20 (20%)
C2H2 Zn finger 1067..1088 CDD:275368 3/20 (15%)
C2H2 Zn finger 1279..1298 CDD:275371 2/18 (11%)
C2H2 Zn finger 1308..1325 CDD:275371 2/16 (13%)
C2H2 Zn finger 1420..1440 CDD:275368
C2H2 Zn finger 1450..1468 CDD:275368
C04F5.9NP_504371.1 C2H2 Zn finger 7..27 CDD:275368
C2H2 Zn finger 36..54 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.