DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31220 and CG9733

DIOPT Version :9

Sequence 1:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:406 Identity:122/406 - (30%)
Similarity:177/406 - (43%) Gaps:99/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CIRLKDCRPIYYNVRRNRLSGSAKVNISQTRMCGVSVRDRKRYKRIYICCP-------------- 83
            |:.:.:|:.:|..::|..|:...| :..::..||     |....:.|:||.              
  Fly    35 CVLINECQTLYSVLKRATLTDQEK-SFIKSSACG-----RGSNNQPYVCCTQDTGYVRIQRQDRT 93

  Fly    84 ---------------------------------KPANT---------------LPSYPDCGKPQT 100
                                             :||.:               ||..|.||....
  Fly    94 FPDYGAFGGDWEEERPQSFVFPRQERRPWSFGNQPATSRTPFRKSSTSDGSSLLPQPPSCGGVGI 158

  Fly   101 TNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQR 165
            .||:..|.:.::||:||:.:|.||.||.    ..|..:|.|||||.|||||||||:|.   :|:|
  Fly   159 RNRIYDGQDTDVNEFPWMVLLEYRRRSG----NGLSTACAGSLINRRYVLTAAHCLTG---RIER 216

  Fly   166 -------VRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLK 223
                   ||||||.|....||...|..  |:|....:..|.|..|..|........:||.|:|::
  Fly   217 EVGTLVSVRLGEHDTRTAVDCPPGGGS--CSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRME 279

  Fly   224 EPVRYTMAYYPICV-----LDYPRSLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEK 283
            ..|||:....|||:     |:..:|..:|.  |||||:| :....|.|.:...|....|.:|.::
  Fly   280 RNVRYSDNIQPICLPSSVGLESRQSGQQFT--VAGWGRT-LKMARSAVKQKVTVNYVDPAKCRQR 341

  Fly   284 YAH--RHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSV 346
            ::.  .:..|. |:||||...:.:||||||.|||.....|:    .|.||.|:|..||...||.|
  Fly   342 FSQIKVNLEPT-QLCAGGQFRKDSCDGDSGGPLMRFRDESW----VLEGIVSFGYKCGLKDWPGV 401

  Fly   347 FTRTAKFYKWIRAHLR 362
            :|..|.:..|||.::|
  Fly   402 YTNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 98/267 (37%)
Tryp_SPc 104..360 CDD:238113 100/269 (37%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855 10/48 (21%)
Tryp_SPc 161..412 CDD:214473 98/267 (37%)
Tryp_SPc 162..415 CDD:238113 100/269 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.