DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31220 and CG18420

DIOPT Version :9

Sequence 1:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:277 Identity:85/277 - (30%)
Similarity:116/277 - (41%) Gaps:53/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DCGKPQTTN---RVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHC 155
            :||......   |::.|.....|..||:| .|:.:.:.|        .|||:||:.|.|||||||
  Fly    30 ECGTRSPLKLGPRIVNGKVAVRNSSPWMA-FLHTSSNQF--------ICGGTLISRRLVLTAAHC 85

  Fly   156 -VTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIAL 219
             :.:|.:.   |||||:...      .:|.|    ..|   .|.....|..|||  .|..|||||
  Fly    86 FIPNTTIV---VRLGEYNRK------LKGYR----EEH---QVNRTFQHRFYDP--NTHANDIAL 132

  Fly   220 VRLKEPVRYTMAYYPICVL---DYPRSLMKFKMYV-AGWGKT-GMFDTGSKVLKHAAVKVRKPEE 279
            :||...|.|.....|||::   .:...:...|:.. .|||:| .|.|  |..|:...:..:..:.
  Fly   133 LRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHD--SSELRTLDISRQPSKM 195

  Fly   280 CSEKYAHRHFGPRF--QICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFL-AGITSYGGPCGTI 341
            |:       ||...  |.|||.. |...|.||:|.| :|...|......|: .||......|.. 
  Fly   196 CA-------FGSVLSNQFCAGNW-NSNLCIGDTGGP-VGAMVRYRNAFRFVQVGIAITNKRCQR- 250

  Fly   342 GWPSVFTRTAKFYKWIR 358
              |||||......::||
  Fly   251 --PSVFTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 81/262 (31%)
Tryp_SPc 104..360 CDD:238113 82/264 (31%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 81/262 (31%)
Tryp_SPc 43..267 CDD:238113 82/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.