DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31200 and CG31199

DIOPT Version :9

Sequence 1:NP_650909.1 Gene:CG31200 / 326124 FlyBaseID:FBgn0051200 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:266 Identity:76/266 - (28%)
Similarity:128/266 - (48%) Gaps:23/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKLVQLLTLAWL-----GALTMAEFRCGRLDE-KLLYTTNEQAEPSENPWVGILLEDQG--NRYE 61
            |::..||.|..|     .:..:.:.:||..|| ::|...:..|.|:|:.||..::..:|  .:..
  Fly     3 GRIAVLLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIR 67

  Fly    62 NTRCSVVIINELHILSTATCVKRFSQRSGDTKAVAM-LGVWDETDSPEEELSCNDKDFCVPGPEL 125
            :..|..|::::..:|:.|.|   |.|.:|..:|.:: |||.::: :|.....|....:||...:.
  Fly    68 DNGCLGVLVSKRTVLAPAHC---FVQYNGVAEAFSVHLGVHNKS-APVGVRVCETDGYCVRPSQE 128

  Fly   126 YKVVEIKVHPQTDKDTGDNDLAILRLEKPVEWTNWVQPICLEGTS-EPETLTNRNLHYTGFNHMA 189
            .|:.||.:||..|..|..|.||:|.|::..:....|.|||:...| ..|||..:.....|.....
  Fly   129 IKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFE 193

  Fly   190 SEKGKGLAMTVS----TQKCKQLTSSSVLVPVNQLCGYPVKRTKFYPGAPLMDIDVRDEKPHNFY 250
            ..:.|....|:|    ..|.|.|.:||     |.:|||..:...:|.||||:.:..:.....|:|
  Fly   194 DFRLKTWVNTLSRGFCQSKVKTLVTSS-----NTVCGYHKQPVAYYLGAPLVGLQKKGHVTQNYY 253

  Fly   251 LVGILV 256
            ||||::
  Fly   254 LVGIMI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31200NP_650909.1 Tryp_SPc 39..282 CDD:304450 66/226 (29%)
Tryp_SPc 39..279 CDD:214473 66/226 (29%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 64/220 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016580
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.