DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31200 and PAMR1

DIOPT Version :9

Sequence 1:NP_650909.1 Gene:CG31200 / 326124 FlyBaseID:FBgn0051200 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_056245.2 Gene:PAMR1 / 25891 HGNCID:24554 Length:737 Species:Homo sapiens


Alignment Length:324 Identity:71/324 - (21%)
Similarity:118/324 - (36%) Gaps:66/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LHSGKLVQLLTLAWLGALTMAEFRCGRLDEKLLYTTNEQAEPSENPWVGILLEDQGNRYENTR-- 64
            |.|.:...|.|..|.|........||:::.    .|..:.:....||...:.......::.:.  
Human   439 LGSSRRTCLRTGKWSGRAPSCIPICGKIEN----ITAPKTQGLRWPWQAAIYRRTSGVHDGSLHK 499

  Fly    65 ------CSVVIINELHILSTATCVKRFSQ----RSGDTKAVAMLGVWDETDSPEEELSCNDKDFC 119
                  ||..::||..::..|.||....:    ::.|.|.|  ||.:...|..:|:..       
Human   500 GAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVV--LGKFYRDDDRDEKTI------- 555

  Fly   120 VPGPELYKVVEIKVHPQTDKDTGDNDLAILRLEKPVEWTNWVQPICLEGTSEPETLTNRNLHYT- 183
                :..::..|.:||..|....|.|:|||:|......:..||||||..:.:..| :.:..|.| 
Human   556 ----QSLQISAIILHPNYDPILLDADIAILKLLDKARISTRVQPICLAASRDLST-SFQESHITV 615

  Fly   184 -GFNHMASEKGKGLAMTVSTQKCKQLTSSSVLVPVNQLC-------GYPVKRT------KFYPGA 234
             |:|.:|..:..|.       |...|.|..|.|..:.||       |.||..|      .:.|.|
Human   616 AGWNVLADVRSPGF-------KNDTLRSGVVSVVDSLLCEEQHEDHGIPVSVTDNMFCASWEPTA 673

  Fly   235 P------------LMDIDVRDEKPHNFYLVGILVRNVD--AGQATTQVYQNVRRARSWIMENLK 284
            |            .:....|......::|:|::..:.|  .....:..:..|...:.||..|:|
Human   674 PSDICTAETGGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHRLSTAFTKVLPFKDWIERNMK 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31200NP_650909.1 Tryp_SPc 39..282 CDD:304450 60/283 (21%)
Tryp_SPc 39..279 CDD:214473 58/280 (21%)
PAMR1NP_056245.2 CUB 128..234 CDD:238001
EGF_CA 240..272 CDD:238011
CCP 297..360 CDD:153056
CCP <425..460 CDD:153056 6/20 (30%)
Tryp_SPc 478..735 CDD:238113 60/277 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.