DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rumi and Poglut2

DIOPT Version :9

Sequence 1:NP_651095.1 Gene:rumi / 326122 FlyBaseID:FBgn0086253 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001264157.1 Gene:Poglut2 / 316370 RGDID:1304684 Length:502 Species:Rattus norvegicus


Alignment Length:377 Identity:99/377 - (26%)
Similarity:174/377 - (46%) Gaps:51/377 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YKPCSSDPQDS-----DCSCHANV--LKRDLAPYKSTGVTRQMIESSARYGTKY----------K 108
            ::.|....:||     :.:|...:  :::||:.:.:....:...|...|:|.:.          |
  Rat   134 HENCDCPLEDSAAWLREMNCPETITQIQKDLSHFPTVDPEKIAAEIPKRFGQRQSLCHYTLKDNK 198

  Fly   109 IY--------GHRLYRDANCMFPARCEGIEHFLLPLV--ATLPDMDLIINTRDYPQLNAAWGNAA 163
            :|        |.|::.||             .||.|.  ..:|:::..:|..|:| |......:.
  Rat   199 VYIKTHGEHVGFRIFMDA-------------ILLSLTRKVRMPEVEFFVNLGDWP-LEKKKSTSN 249

  Fly   164 GGPVFSFSKTKEYRDIMYPAWTFWAGGPATKLHPRGIGRWDQMREKLEKRAAAIPWSQKRSLGFF 228
            ..|:||:..:.|.|||:.|.:..    ..:.|...|....|.|..:..   ...||..|.|...:
  Rat   250 IQPIFSWCGSTESRDIVMPTYDL----TDSVLETMGRVSLDMMSVQAN---TGPPWESKNSTAVW 307

  Fly   229 RGSRTSDERDSLILLSRRNPELVEAQYTKNQGWKSPKDTLDAPAADEVSFEDHCKYKYLFNFRGV 293
            ||..:..||..|:.|||::|||::|.:| |..:....::|..|....:||.|..|:||..|..|.
  Rat   308 RGRDSRKERLELVKLSRKHPELIDAAFT-NFFFFKHDESLYGPIVKHISFFDFFKHKYQINVDGT 371

  Fly   294 AASFRLKHLFLCKSLVFHVGDEWQEFFYDQLKPWVHYVPLKSYPSQQEYEHILSFFKKNDALAQE 358
            .|::||.:|.:..|:|......:.|.||::|:||.||:|:||  :..:....|.:.:.:||.|::
  Rat   372 VAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKS--NLSDLLEKLKWARDHDAEAKK 434

  Fly   359 IAQRGYDFIWEHLRMKDIKCYWRKLLKRYVKLLQYEVKPEDQLIYIGPKKDE 410
            ||:.|.:|...:|...||.||:.||.:.|..|...|.:..:.:..:.|:.::
  Rat   435 IAKAGQEFARNNLMGDDIFCYYFKLFQGYANLQVSEPQIREGMKRVEPQSED 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumiNP_651095.1 CAP10 139..394 CDD:214773 79/254 (31%)
Poglut2NP_001264157.1 Filamin 28..127 CDD:279024
IG_FLMN 29..129 CDD:214720
Glyco_transf_90 151..484 CDD:283366 96/356 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2458
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.