DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rumi and POGLUT3

DIOPT Version :9

Sequence 1:NP_651095.1 Gene:rumi / 326122 FlyBaseID:FBgn0086253 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_714916.3 Gene:POGLUT3 / 143888 HGNCID:28496 Length:507 Species:Homo sapiens


Alignment Length:361 Identity:96/361 - (26%)
Similarity:162/361 - (44%) Gaps:44/361 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DYKPCSSDPQ----DSDCSCHANVLKRDLAPYKSTGVTRQMIESSARYGTK------YKIYGHRL 114
            :|..|..|||    ...|......:.:|.|.:.|..:.:.:.|...|:|.:      |.|..:.:
Human   139 EYCECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLKEVPKRFGDERGAIVHYTILNNHV 203

  Fly   115 YRDANCMFPARCEGIEHFLLPLV--ATLPDMDLIINTRDYP----QLNAAWGNAAGGPVFSFSKT 173
            ||.:...:.......:..||.|.  ..|||::..:|..|:|    ::|   |..:..|:.|:..:
Human   204 YRRSLGKYTDFKMFSDEILLSLTRKVLLPDLEFYVNLGDWPLEHRKVN---GTPSPIPIISWCGS 265

  Fly   174 KEYRDIMYPAWTFWAGGPATKLHP-----RGIGRWDQMREKLEKRAAAIP-WSQKRSLGFFRGSR 232
            .:.||::.|.:..        .|.     ||:     ..:.|..:....| |..|....||||..
Human   266 LDSRDVVLPTYDI--------THSMLEAMRGV-----TNDLLSIQGNTGPSWINKTERAFFRGRD 317

  Fly   233 TSDERDSLILLSRRNPELVEAQYTKNQGWKSPKDTLDAPAADEVSFEDHCKYKYLFNFRGVAASF 297
            :.:||..|:.||:.||:|::|..|....::..:..|.  .|..:.|.|..||||..|..|..|::
Human   318 SREERLQLVQLSKENPQLLDAGITGYFFFQEKEKELG--KAKLMGFFDFFKYKYQVNVDGTVAAY 380

  Fly   298 RLKHLFLCKSLVFHVGDEWQEFFYDQLKPWVHYVPLKSYPSQQEYEHILSFFKKNDALAQEIAQR 362
            |..:|.|..|||......:.|.||..|:||.||||:|.  :..:....:.:.|:||..|::||:.
Human   381 RYPYLMLGDSLVLKQDSPYYEHFYMALEPWKHYVPIKR--NLSDLLEKVKWAKENDEEAKKIAKE 443

  Fly   363 GYDFIWEHLRMKDIKCYWRKLLKRYVKLLQYEVKPE 398
            |.....:.|:...:.||:.::|::|.:  :...|||
Human   444 GQLMARDLLQPHRLYCYYYQVLQKYAE--RQSSKPE 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rumiNP_651095.1 CAP10 139..394 CDD:214773 74/264 (28%)
POGLUT3NP_714916.3 Filamin 24..134
Filamin 27..131 CDD:279024
IG_FLMN 29..133 CDD:214720
Glyco_transf_90 151..485 CDD:304992 91/349 (26%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 504..507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2458
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.