DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and csdE

DIOPT Version :10

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_417291.1 Gene:csdE / 947274 ECOCYCID:G7455 Length:147 Species:Escherichia coli


Alignment Length:31 Identity:10/31 - (32%)
Similarity:17/31 - (54%) Gaps:2/31 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EKFNDLTLI-KRHRLVNDTVKNALKE-AGFE 117
            :|:..|.:: |:...:.|.:|...|| ||.|
E. coli    32 DKYRQLIMLGKQLPALPDELKAQAKEIAGCE 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 45..133 CDD:440041 10/31 (32%)
csdENP_417291.1 PRK15019 1..147 CDD:184980 10/31 (32%)

Return to query results.
Submit another query.