DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and BOL2

DIOPT Version :9

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_011295.1 Gene:BOL2 / 852652 SGDID:S000003188 Length:120 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:26/100 - (26%)
Similarity:45/100 - (45%) Gaps:10/100 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RATMSQEAGQYPPIESAMRKALNTELKPVYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLI 97
            |.|..|...:.|..|..:|:.:.:.:..||..::.:     :.......|.:.|||:.|...:.:
Yeast    26 RETKRQRHYKMPVTEQGLRERIESAIPQVYHIIVTD-----LSYGCGQSFDIVVVSDFFQGKSKL 85

  Fly    98 KRHRLVNDTVKNALKEAGFEFMHALSIEAKTPKQW 132
            .|.|.||..||..|:|     :||.|.:..|.::|
Yeast    86 MRSRAVNKAVKEELQE-----IHAFSCKCYTEEEW 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 54..131 CDD:279982 19/76 (25%)
BOL2NP_011295.1 BolA 23..116 CDD:223349 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.