DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and BOL1

DIOPT Version :9

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_075206.1 Gene:BOL1 / 851252 SGDID:S000007586 Length:110 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:31/100 - (31%)
Similarity:54/100 - (54%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PIESAMRKALN---TELKPVYLEVINESPQH--------NVPKRSESHFRVFVVSEKFNDLTLIK 98
            |:...:.|.|.   .:.|.....:.|:|.:|        ||  .:|:|||:.:||:||..|.|.:
Yeast    11 PVARTILKRLECGFPDYKNFAFGLYNDSHKHKGHAGVQGNV--SAETHFRIEMVSKKFEGLKLPQ 73

  Fly    99 RHRLVNDTVKNALKEAGFEFMHALSIEAKTPKQWE 133
            |||:|...:::.:.:|  ..:|||.:..|||:::|
Yeast    74 RHRMVYSLLQDEMAQA--NGIHALQLSLKTPQEYE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 54..131 CDD:279982 28/87 (32%)
BOL1NP_075206.1 BolA 35..104 CDD:396332 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343075
Domainoid 1 1.000 44 1.000 Domainoid score I3165
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 1 1.000 - - oto98997
orthoMCL 1 0.900 - - OOG6_101206
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 1 1.000 - - X3109
TreeFam 1 0.960 - -
1110.630

Return to query results.
Submit another query.